Beta-defensin 103 isoform X1, pig
Description
Beta-defensin 103 isoform X1, pig is an antimicrobial peptide found in a variety of organisms and is involved in the first line of defense of innate immunity.
Product Details
| Product Name | Beta-defensin 103 isoform X1, pig |
| Biological activity | Beta-defensin 103 isoform X1, pig is an antimicrobial peptide found in different living organisms, involved in the first line of defense in their innate immune response against pathogens. |
| Sequence | Met-Arg-Ile-His-Tyr-Leu-Leu-Phe-Ala-Leu-Leu-Phe-Leu-Phe-Leu-Met-Pro-Leu-Pro-Gly-Asn-Gly-Arg-Ile-Ile-Asn-Thr-Leu-Gln-Arg-Tyr-Tyr-Cys-Lys-Ile-Arg-Arg-Gly-Arg-Cys-Ala-Val-Leu-Gly-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Ser-Cys-Ser-Val-Ser-Gly-Arg-Lys-Cys-Cys-Arg-Lys-Arg-Lys |
| Sequence Shortening | MRIHYLLFALLFLFLMPLPGNGRIINTLQRYYCKIRRGRCAVLGCLPKEEQIGSCSVSGRKCCRKRK |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
