Insert HTML here
Showing 2545–2560 of 3705 results
Product Name Cortistatin-29 (rat) Biological activity Cortistatin-29 is a neuropeptide. Cortistatin-29 alleviates neuropathic pain. Cortistatin-29 binds all somatostatin (SS) receptor subtypes with high affinity and shows IC50 values of 2.8 nM, 7.1 nM, 0.2 nM, 3.0 nM, 13.7 nM for SSTR1, SSTR2, SSTR3, SSTR4, SSTR5, respectively. Cortistatin-29 shows anti-fibrotic effects. Molecular Weight 3540.04 Formula Formula…
Product Name [Glp5] Substance P (5-11) Biological activity Substance P (5-11) is an octapeptide. Substance P (5-11) is one of the main substance P fragments in rat central nervous system (CNS). Substance P (5-11) locally modulates dopamine release in rat striatum. Formula Formula C41H57N9O9S CAS Number 56104-22-4 Sequence Shortening Sequence Shortening Glp-QFFGLM-NH2 Storage Please store…
Application: T-cell immunity Category: Antigen Peptides Layout: Freeze-dried in glass vial Organism: Human Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-FASGLIHRV-OH Specifications: 9mer peptide as TFA salt
KIKIKPWWWPKIKIK-NH2 is a ??-turn antimicrobial peptide. KIKIKPWWWPKIKIK-NH2 inhibits bacterial biofilm formation and binds lipopolysaccharide. KIKIKPWWWPKIKIK-NH2 demonstrates wound-healing capacity in a mouse model of bacterial-infected full-thickness wounds. KIKIKPWWWPKIKIK-NH2 can be used in research on bacterial infections. Product Details Product Name KIKIKPWWWPKIKIK-NH2 Biological activity KIKIKPWWWPKIKIK-NH2 is a ??-turn antimicrobial peptide. KIKIKPWWWPKIKIK-NH2 can inhibit bacterial biofilm formation and…
Product Name ACTH (22-39) Biological activity ACTH (22-39) is an adrenocorticotropic hormone (ACTH) fragment. ACTH (22-39) is the 22-39 sequence of ACTH. Formula Formula C90H125N19O32 CAS Number 37548-29-1 Appearance Solid Color White to off-white Sequence Sequence Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe Sequence Shortening Sequence Shortening VYPNGAEDESAEAFPLEF Storage Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year…
Product Name GIP, human TFA Biological activity GIP, human TFA, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human TFA acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion. Formula Formula C226H338N60O66S.xC2HF3O2 Appearance…
Kisspeptin-10, human is a potent vasoconstrictor and inhibitor of angiogenesis. Kisspeptin-10, human acts as a tumor metastasis suppressor via its receptor GPR54. Kisspeptin-10-GPR54 system plays an important role in embryonic kidney development. Kisspeptin-10/GPR54 signaling induces osteoblast differentiation via NFATc4-mediated BMP2 expression. Product Information Product Name Kisspeptin-10, human Molecular Weight 1302.44 Formula C63H83N17O14 CAS Number 374675-21-5…
Kisspeptin-10, human TFA is a potent vasoconstrictor and inhibitor of angiogenesis. Kisspeptin-10, human TFA acts as a tumor metastasis suppressor via its receptor GPR54. Kisspeptin-10-GPR54 system plays an important role in embryonic kidney development. Kisspeptin-10/GPR54 signaling induces osteoblast differentiation via NFATc4-mediated BMP2 expression. Product Information Product Name Kisspeptin-10, human TFA Molecular Weight 1416.46 Formula C63H83N17O14.C2HF3O2…
Product Name β-Melanocyte Stimulating Hormone (MSH), human Biological activity β-Melanocyte Stimulating Hormone (MSH), human, a 22-residue peptide, acts as an endogenous melanocortin-4 receptor (MC4-R) agonist. Molecular Weight 2660.92 Formula Formula C118H174N34O35S CAS Number 17908-57-5 Appearance Solid Color White to off-white Sequence Sequence Ala-Glu-Lys-Lys-Asp-Glu-Gly-Pro-Tyr-Arg-Met-Glu-His-Phe-Arg-Trp-Gly-Ser-Pro-Pro-Lys-Asp Sequence Shortening Sequence Shortening AEKKDEGPYRMEHFRWGSPPKD
Product Name Leptin (116-130) (human) Biological activity Leptin (116-130) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development. CAS…
Product Name Galanin (1-29)(rat, mouse) TFA Biological activity Galanin (1-29)(rat, mouse) TFA is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3, respectively. Anticonvulsant effect. Appearance Solid Color White to off-white Sequence Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2 Sequence Shortening Sequence Shortening GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2 Storage Sealed storage, away from moisture and…
Product Name Xenin-8 TFA Biological activity Xenin-8 TFA is the C-terminal octapeptide fragment of xenin, which belongs to the xenopsin family of peptides. Xenin-8 TFA stimulates basal insulin secretion, dose-dependently enhances glucose (EC50 = 0.16 nM) and arginine-induced insulin release, and enhances arginine- and Carbamoylcholine chloride (HY-B1208)-induced glucagon secretion. Xenin-8 TFA antagonizes the inhibition of…
KK14(R) is an analog of the de novo synthesized peptide KK14 with antifungal activity, with MIC values of 6.25, 12.5, and 12.5 ??g/mL against Fusarium culmorum, Penicillium expansum, and Aspergillus niger, respectively. KK14(R) has good thermal and pH stability. KK14(R) is cytotoxic to Caco-2 and RAW264.7 cells. Product Details Product Name KK14(R) Biological activity KK14(R)…
KR-12 (human) is an active fragment of LL-37 (HY-P4744). KR-12 (human) has antibacterial activity against Gram-negative bacteria. KR-12 (human) inhibits E. coli K-12 with an MIC value of 66 ??M. KR-12 (human) can be used in infection research, such as Escherichia coli infection. Product Details Product Name KR-12 (human) Biological activity KR-12 (human) is an…
KRES peptide is an apolipoprotein with 4 amino acid residues. KRES peptide interacts with lipids, reduces lipoprotein lipid hydroperoxides (LOOH), activates antioxidant enzymes associated with high-density lipoprotein. KRES peptide exhibits anti-inflammatory and anti-atherogenic properties. KRES peptide is orally active. Product Information Product Name KRES peptide Molecular Weight 518.56 Formula C20H38N8O8 CAS Number 867376-23-6 Sequence Lys-Arg-Glu-Ser…
KSL-W is a multifunctional antibacterial peptide with immunomodulatory functions. KSL-W has chemotactic effects on neutrophils. KSL-W induces neutrophil F-actin polymerization in a manner dependent on the G??i protein signaling pathway. KSL-W inhibits the production of reactive oxygen species (ROS) in neutrophils. KSL-W can be used in research on infection control and inflammation regulation. Product Details…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us