Insert HTML here
Showing 2529–2544 of 3705 results
Amount: 20 mg net (AAA) Application: Drug delivery, Tissue engineering Category: Hydrogel Forming Peptides Condition / Topic: Regenerative medicine Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Self-assembling peptide Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: Yes Sequence: Ac-IV-Cha-K-NH2 (synthetic); Cha=3-cyclohexyl-L-alanine
JB-95 is a ??-hairpin macrocyclic peptide with potent antibacterial activity against Escherichia coli. JB-95 selectively disrupts the outer membrane of E. coli without disrupting the inner membrane. Product Details Product Name JB-95 Biological activity JB-95, a ??-hairpin macrocyclic peptide, exhibits potent antimicrobial activity against Escherichia coli. JB-95 can selectively disrupt the outer membrane but not…
JB-95 acetate is a ??-hairpin macrocyclic peptide with potent antibacterial activity against Escherichia coli. JB-95 acetate selectively disrupts the outer membrane of E. coli without disrupting the inner membrane. Product Details Product Name JB-95 acetate Biological activity JB-95 acetate, a ??-hairpin macrocyclic peptide, exhibits potent antimicrobial activity against Escherichia coli. JB-95 acetate can selectively disrupt…
Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Infection, Opportunistic infections, Progressive multifocal leukoencephalopathy (PML) Layout: Freeze-dried in glass vial Organism: JC polyomavirus Protein Name: Large T antigen Purity: Development Grade: each peptide purified to >…
Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Infection, Opportunistic infections, Progressive multifocal leukoencephalopathy (PML) Layout: Freeze-dried in glass vial Organism: JC polyomavirus Protein Name: Major capsid protein VP1 Purity: Development Grade: each peptide purified to…
Jelleine-I is an antimicrobial peptide. Jelleine-I can be purified from bee royal jelly. Jelleine-I has antibacterial activity against yeast, fungi, Gram-positive bacteria, and Gram-negative bacteria. Product Details Product Name Jelleine-I Biological activity Jelleine-I is an antimicrobial peptide. Jelleine-I can be purified from royal jelly of honeybees. Jelleine-I exhibits antimicrobial activities against yeast, fungi, Gram-positive and…
Jelleine-II is a short-chain antibacterial peptide from royal jelly with broad-spectrum antibacterial activity. Jelleine-II has antibacterial activity against yeast, fungi, Gram-positive bacteria, and Gram-negative bacteria. Jelleine-II can be used in research on infectious diseases. Product Details Product Name Jelleine-II Biological activity Jelleine-II is a short chain antibacterial peptide derived from royal jelly, with broad-spectrum antibacterial…
Product Name [Ala6]-LHRH Biological activity -LHRH is a synthetic luteinizing hormone-releasing hormone agonist, demonstrating effective stimulation of pituitary luteinizing hormone secretion. -LHRH enhances reproductive hormone regulation, contributing to fertility treatments. -LHRH plays a crucial role in managing conditions related to hormone imbalances. CAS Number 51278-35-4 Sequence Sequence {Pyr}-His-Trp-Ser-Tyr-Ala-Leu-Arg-Pro-Gly-NH2 Sequence Shortening Sequence Shortening {Pyr}-HWSYALRPG-NH2 Storage Please…
K11 is an antimicrobial peptide. K11 is active against MDR/XDR K. pneumoniae (MIC: 8-512 ??g/mL) and inhibits bacterial biofilm formation. K11 acts synergistically with antibiotics (Chloramphenicol (HY-B0239), Meropenem (HY-13678), Rifampicin (HY-B0272), etc.) against drug-resistant K. pneumoniae. K11 has high thermal stability and broad pH stability. Product Details Product Name K11 Biological activity K11 is an…
Kahalalide A is an antimycobacterial compound with antimicrobial activity. Kahalalide A is derived from the marine mollusk Elysia rufescens. Kahalalide A has received extensive attention in natural product research because of its potential medicinal value. Product Details Product Name Kahalalide A Biological activity Kahalalide A is an anti-mycobacterial compound with antimicrobial activity. Kahalalide A is…
Amount: 1 mg Application: Drug delivery Category: Cell-Penetrating Peptides Condition / Topic: Cancer, Gene therapy Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: CPP Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-WEAKLAKALAKALAKHLAKALAKALKA-OH
KAMP-19, a keratin-derived antimicrobial peptide, has antibacterial activity against Pseudomonas aeruginosa (P. aeruginosa). Product Details Product Name KAMP-19 Biological activity KAMP-19, a keratin-derived antimicrobial peptide, is an antimicrobial peptide against P. aeruginosa. . Sequence Arg-Ala-Ile-Gly-Gly-Gly-Leu-Ser-Ser-Val-Gly-Gly-Gly-Ser-Ser-Thr-Ile-Lys-Tyr Sequence Shortening RAIGGGLSSVGGGSSTIKY Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Amount: 0.5 mg Application: Proteomics Category: Antimicrobial Peptides Condition / Topic: Antimicrobial Layout: Freeze-dried in plastic vial Modification: None Organism: Human Protein Name: Keratin Purity: >95% (HPLC-MS) Quantification: No Sequence: H-RAIGGGLSSVGGGSSTIKY-OH Specifications: Antimicrobial peptide
Product Name Crustacean cardioactive peptide??free acid Biological activity Crustacean cardioactive peptide, free acid is a highly conserved, amidated cyclic nonapeptide, first isolated from the pericardial organs of the shore crab Carcinus maenas, where it has a role in regulating heartbeat; Crustacean cardioactive peptide, free acid also modulates the neuronal activity in other arthropods. Molecular Weight…
Product Name Calcitonin, eel TFA Biological activity Calcitonin, eel TFA is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis. Formula Formula C148H242F3N43O49S2 Appearance Solid Color White to off-white Sequence Sequence Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro-NH2 (Disulfide bridge: Cys1-Cys7) Sequence Shortening Sequence Shortening CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 (Disulfide bridge: Cys1-Cys7) Storage…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us