peptides

Amount: 15 nmol (approx. 25??g) / peptide for stimulation of 2,5 x 108 cells Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Control, Cytomegalovirus disease Layout: Freeze-dried in glass vial Organism: Cynomolgus macaque cytomegalovirus (CyCMV) Protein Name: Selected proteins Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: see…

Amount: 1 mg Application: Drug delivery Category: Cell-Penetrating Peptides Condition / Topic: Cancer, Gene therapy Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: CPP Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-CRRRRRRRR-OH

Amount: 1 mg Application: Drug delivery Category: Cell-Penetrating Peptides Condition / Topic: Cancer, Gene therapy Layout: Freeze-dried in plastic vial Organism: Human immunodeficiency virus (HIV) Protein Name: CPP Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-ygrkkrrqrrr-OH

Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVVIA Specifications: Point mutated synthetic Beta-Amyloid peptide (1-42)

Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Dengue fever Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Dengue virus Protein Name: Genome polyprotein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-GTSGSPIADK-OH Specifications: 10mer peptide as TFA salt

Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Dependoparvovirus primate1 Protein Name: Capsid protein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-NSLANPGIA-OH Specifications: 9mer peptide as TFA salt

Application: Nuclear medicine Category: Chelate Peptides (DOTA) Condition / Topic: Cancer Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Other Purity: >95% (HPLC-MS) Quantification: No Sequence: RGD-DPhe-Lys(DOTA), head-to-tail cyclized

Application: Nuclear medicine Category: Chelate Peptides (DOTA) Condition / Topic: Cancer Layout: Freeze-dried in glass vial Organism: Other/None Protein Name: Other Purity: >95% (HPLC-MS) Quantification: No Sequence: DPhe-Cys-1Nal-DTrp-Lys-Thr-Cys-Thr-ol (cyclic disulfide) Specifications: DOTA-NOC (DOTA-[Nal3]-octreotide)