Showing 449–464 of 1666 results
![DOTA-TOC (DOTA-[Tyr3]-octreotide)](https://www.qyaobio.com/wp-content/uploads/2026/07/peptides2-300x300.jpg)
Application: Nuclear medicine Category: Chelate Peptides (DOTA) Condition / Topic: Cancer Layout: Freeze-dried in glass vial Organism: Other/None Protein Name: Other, Other;Selected proteins Purity: >95% (HPLC-MS) Quantification: No Sequence: DPhe-Cys-Tyr-DTrp-Lys-Thr-Cys-Thr-ol (cyclic disulfide) Specifications: DOTA-TOC (DOTA-[Tyr3]-octreotide)
Amount: 0.5 mg Application: Proteomics Category: Antimicrobial Peptides Condition / Topic: Antimicrobial Layout: Freeze-dried in plastic vial Modification: None Organism: Insect Purity: >95% (HPLC-MS) Quantification: No Sequence: H-GKPRPYSPRPTSHPRPIRV-OH Specifications: Antimicrobial peptide
Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Allergy Layout: Freeze-dried in glass vial Organism: Dermatophagoides pteronyssinus Protein Name: Allergen Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: MMYKILCLSLLVAAVARDQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNTKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDDGVLACAIATHAKIRD Specifications: Peptide…
Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: DAEFRHNSGYKVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Specifications: Point mutated synthetic Beta-Amyloid peptide (1-42)
Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA Specifications: Point mutated synthetic Beta-Amyloid peptide (1-42)
Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA Specifications: Point mutated synthetic Beta-Amyloid peptide (1-42)
Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA Specifications: Point mutated synthetic Beta-Amyloid peptide (1-42)
Amount: 20 mg net (AAA) Application: Drug delivery, Tissue engineering Category: Hydrogel Forming Peptides Condition / Topic: Regenerative medicine Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Self-assembling peptide Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: Yes Sequence: Ac-AEAEAKAKAEAEAKAK-NH2 (synthetic)
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Autoimmune disease, Burkitt’s lymphoma, Hodgkin’s lymphoma, Infection, Infectious mononucleosis, Nasopharyngeal carcinoma Layout: Freeze-dried in glass vial Organism: Epstein-Barr Virus (EBV) Protein Name: Secreted protein…
Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Autoimmune disease, Burkitt’s lymphoma, Hodgkin’s lymphoma, Infection, Infectious mononucleosis, Nasopharyngeal carcinoma Layout: Freeze-dried in glass vial Organism: Epstein-Barr Virus (EBV) Protein Name: Apoptosis regulator Purity: Development Grade: each…
Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Autoimmune disease, Burkitt’s lymphoma, Hodgkin’s lymphoma, Infection, Infectious mononucleosis, Nasopharyngeal carcinoma Layout: Freeze-dried in glass vial Organism: Epstein-Barr Virus (EBV) Protein Name: Glycoprotein Purity: Development Grade: each peptide…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Autoimmune disease, Burkitt’s lymphoma, Hodgkin’s lymphoma, Infection, Infectious mononucleosis, Nasopharyngeal carcinoma Layout: Freeze-dried in glass vial Organism: Epstein-Barr Virus (EBV) Protein Name: BMLF1 (mRNA…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Autoimmune disease, Burkitt’s lymphoma, Hodgkin’s lymphoma, Infection, Infectious mononucleosis, Nasopharyngeal carcinoma Layout: Freeze-dried in glass vial Organism: Epstein-Barr Virus (EBV) Protein Name: DNA polymerase…
Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Autoimmune disease, Burkitt’s lymphoma, Hodgkin’s lymphoma, Infection, Infectious mononucleosis, Nasopharyngeal carcinoma Layout: Freeze-dried in glass vial Organism: Epstein-Barr Virus (EBV) Protein Name: Protein Purity: Development Grade: each peptide…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Autoimmune disease, Burkitt’s lymphoma, Hodgkin’s lymphoma, Infection, Infectious mononucleosis, Nasopharyngeal carcinoma Layout: Freeze-dried in glass vial Organism: Epstein-Barr Virus (EBV) Protein Name: Transcription factors/activators…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Autoimmune disease, Burkitt’s lymphoma, Hodgkin’s lymphoma, Infection, Infectious mononucleosis, Nasopharyngeal carcinoma Layout: Freeze-dried in glass vial Organism: Epstein-Barr Virus (EBV) Protein Name: BZLF1 Trans-activator…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to peptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us
