OFFICIAL STATEMENT-Regarding Fraudulent Websites

peptides

  • DOTA-TOC (DOTA-[Tyr3]-octreotide)

    DOTA-TOC (DOTA-[Tyr3]-octreotide)

    Application: Nuclear medicine Category: Chelate Peptides (DOTA) Condition / Topic: Cancer Layout: Freeze-dried in glass vial Organism: Other/None Protein Name: Other, Other;Selected proteins Purity: >95% (HPLC-MS) Quantification: No Sequence: DPhe-Cys-Tyr-DTrp-Lys-Thr-Cys-Thr-ol (cyclic disulfide) Specifications: DOTA-TOC (DOTA-[Tyr3]-octreotide)

  • Drosocin Peptide

    Drosocin Peptide

    Amount: 0.5 mg Application: Proteomics Category: Antimicrobial Peptides Condition / Topic: Antimicrobial Layout: Freeze-dried in plastic vial Modification: None Organism: Insect Purity: >95% (HPLC-MS) Quantification: No Sequence: H-GKPRPYSPRPTSHPRPIRV-OH Specifications: Antimicrobial peptide

  • Dust Mite (Allergen Der p 2)

    Dust Mite (Allergen Der p 2)

    Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Allergy Layout: Freeze-dried in glass vial Organism: Dermatophagoides pteronyssinus Protein Name: Allergen Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: MMYKILCLSLLVAAVARDQVDVKDCANHEIKKVLVPGCHGSEPCIIHRGKPFQLEAVFEANQNTKTAKIEIKASIDGLEVDVPGIDPNACHYMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKVMGDDGVLACAIATHAKIRD Specifications: Peptide…

  • E11K-Beta-Amyloid (1-42) HFIP treated

    E11K-Beta-Amyloid (1-42) HFIP treated

    Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: DAEFRHNSGYKVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Specifications: Point mutated synthetic Beta-Amyloid peptide (1-42)

  • E22G-Beta-Amyloid (1-42) HFIP treated

    E22G-Beta-Amyloid (1-42) HFIP treated

    Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA Specifications: Point mutated synthetic Beta-Amyloid peptide (1-42)

  • E22K-Beta-Amyloid (1-42) HFIP treated

    E22K-Beta-Amyloid (1-42) HFIP treated

    Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA Specifications: Point mutated synthetic Beta-Amyloid peptide (1-42)

  • E22Q-Beta-Amyloid (1-42) HFIP treated

    E22Q-Beta-Amyloid (1-42) HFIP treated

    Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA Specifications: Point mutated synthetic Beta-Amyloid peptide (1-42)

  • EAK16-II (CAS 157675-61-1)

    EAK16-II (CAS 157675-61-1)

    Amount: 20 mg net (AAA) Application: Drug delivery, Tissue engineering Category: Hydrogel Forming Peptides Condition / Topic: Regenerative medicine Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Self-assembling peptide Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: Yes Sequence: Ac-AEAEAKAKAEAEAKAK-NH2 (synthetic)

  • EBV (BARF1)

    EBV (BARF1)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Autoimmune disease, Burkitt’s lymphoma, Hodgkin’s lymphoma, Infection, Infectious mononucleosis, Nasopharyngeal carcinoma Layout: Freeze-dried in glass vial Organism: Epstein-Barr Virus (EBV) Protein Name: Secreted protein…

  • EBV (BHRF1)

    EBV (BHRF1)

    Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Autoimmune disease, Burkitt’s lymphoma, Hodgkin’s lymphoma, Infection, Infectious mononucleosis, Nasopharyngeal carcinoma Layout: Freeze-dried in glass vial Organism: Epstein-Barr Virus (EBV) Protein Name: Apoptosis regulator Purity: Development Grade: each…

  • EBV (BILF2)

    EBV (BILF2)

    Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Autoimmune disease, Burkitt’s lymphoma, Hodgkin’s lymphoma, Infection, Infectious mononucleosis, Nasopharyngeal carcinoma Layout: Freeze-dried in glass vial Organism: Epstein-Barr Virus (EBV) Protein Name: Glycoprotein Purity: Development Grade: each peptide…

  • EBV (BMLF1)

    EBV (BMLF1)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Autoimmune disease, Burkitt’s lymphoma, Hodgkin’s lymphoma, Infection, Infectious mononucleosis, Nasopharyngeal carcinoma Layout: Freeze-dried in glass vial Organism: Epstein-Barr Virus (EBV) Protein Name: BMLF1 (mRNA…

  • EBV (BMRF1)

    EBV (BMRF1)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Autoimmune disease, Burkitt’s lymphoma, Hodgkin’s lymphoma, Infection, Infectious mononucleosis, Nasopharyngeal carcinoma Layout: Freeze-dried in glass vial Organism: Epstein-Barr Virus (EBV) Protein Name: DNA polymerase…

  • EBV (BNLF2a)

    EBV (BNLF2a)

    Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Autoimmune disease, Burkitt’s lymphoma, Hodgkin’s lymphoma, Infection, Infectious mononucleosis, Nasopharyngeal carcinoma Layout: Freeze-dried in glass vial Organism: Epstein-Barr Virus (EBV) Protein Name: Protein Purity: Development Grade: each peptide…

  • EBV (BRLF1)

    EBV (BRLF1)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Autoimmune disease, Burkitt’s lymphoma, Hodgkin’s lymphoma, Infection, Infectious mononucleosis, Nasopharyngeal carcinoma Layout: Freeze-dried in glass vial Organism: Epstein-Barr Virus (EBV) Protein Name: Transcription factors/activators…

  • EBV (BZLF1)

    EBV (BZLF1)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Autoimmune disease, Burkitt’s lymphoma, Hodgkin’s lymphoma, Infection, Infectious mononucleosis, Nasopharyngeal carcinoma Layout: Freeze-dried in glass vial Organism: Epstein-Barr Virus (EBV) Protein Name: BZLF1 Trans-activator…