peptides

Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: DVEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV Specifications: Point mutated synthetic A beta peptide (1-40)

Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: DVEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Specifications: Point mutated synthetic Beta-Amyloid peptide (1-42)

Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Cancer, Gene therapy, Infection Layout: Freeze-dried in glass vial Organism: Adeno-Associated Virus (AAV) Protein Name: Capsid protein Purity: Development Grade: each peptide purified to…

Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Gene therapy, Infection Layout: Freeze-dried in glass vial Organism: Adeno-Associated Virus (AAV) Protein Name: Capsid protein Purity: >70% (HPLC-MS), Development Grade: each peptide purified…

Application: T-cell immunity Category: Antigen Peptides Layout: Freeze-dried in glass vial Organism: Human Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-MKLGTWTYDGSVV-OH Specifications: 13mer peptide as TFA salt

Application: T-cell immunity Category: Antigen Peptides Layout: Freeze-dried in glass vial Organism: Human Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-IIGTLAVFAGRLIELNQQG-OH Specifications: 19mer peptide as TFA salt

Amount: 1 microarray (1″ x 3″) Application: Enzymology Category: Enzyme Substrate Arrays Condition / Topic: Acetyltransferase, Deacetylase, Epigenetics Layout: 1-sample peptide microarray, 21-sample peptide microarray Organism: Human Protein Name: Selected proteins Quantification: No Sequence: See Sequence List under Product Documentation Specifications: 13 mer peptides selected form the human proteome

Amount: 1 mg Application: Cancer biomarker research Category: Cancer peptides Layout: Freeze-dried in plastic vial Organism: Plasmodium Protein Name: ADP-Ribosylation Factor 1 Purity: >90% (HPLC-MS) Quantification: No Sequence: H-GNIFANLFKGLFGKKE-NH2 Specifications: 16mer cancer peptide