Ecallantide (DX-88) is a specific plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide can be used to prevent acute attacks of angioedema. Product Information Product Name Ecallantide Molecular Weight 7053.81 Formula C305H442N88O91S8 CAS Number 460738-38-9 Sequence Glu-Ala-Met-His-Ser-Phe-Cys-Ala-Phe-Lys-Ala-Asp-Asp-Gly-Pro-Cys-Arg-Ala-Ala-His-Pro-Arg-Trp-Phe-Phe-Asn-Ile-Phe-Thr-Arg-Gln-Cys-Glu-Glu-Phe-Ile-Tyr-Gly-Gly-Cys-Glu-Gly-Asn-Gln-Asn-Arg-Phe-Glu-Ser-Leu-Glu-Glu-Cys-Lys-Lys-Met-Cys-Thr-Arg-Asp (Disulfide bond:Cys1-Cys6, Cys2-Cys4, Cys3-Cys5) Sequence Shortening EAMHSFCAFKADDGPCRAAHPRWFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRD (Disulfide bond:Cys1-Cys6, Cys2-Cys4, Cys3-Cys5)
Ecallantide (DX-88) TFA is a specific recombinant plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide may be used to prevent acute attacks of angioedema. Product Information Product Name Ecallantide TFA Molecular Weight 7053.81 (free base) Formula C305H442N88O91S8.xC2HF3O2 Appearance Solid Color White to off-white Sequence Glu-Ala-Met-His-Ser-Phe-Cys-Ala-Phe-Lys-Ala-Asp-Asp-Gly-Pro-Cys-Arg-Ala-Ala-His-Pro-Arg-Trp-Phe-Phe-Asn-Ile-Phe-Thr-Arg-Gln-Cys-Glu-Glu-Phe-Ile-Tyr-Gly-Gly-Cys-Glu-Gly-Asn-Gln-Asn-Arg-Phe-Glu-Ser-Leu-Glu-Glu-Cys-Lys-Lys-Met-Cys-Thr-Arg-Asp (Disulfide bond:Cys1-Cys6, Cys2-Cys4, Cys3-Cys5) Sequence Shortening EAMHSFCAFKADDGPCRAAHPRWFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRD (Disulfide…
EcAMP3 is a hairpin-like polypeptide. EcAMP3 has antifungal and antibacterial activities. The EcAMPs precursor family contains seven identical cysteine motifs: C1XXXC2(11-13)C3XXXC4. Product Details Product Name EcAMP3 Biological activity EcAMP3 is a hairpin-like peptide. EcAMP3 has antifungal and antibacterial activity. EcAMPs precursor family contains seven identical cysteine motifs: C1XXXC2(11?C13)C3XXXC4. Sequence Gly-Ala-Asp-Arg-Cys-Arg-Glu-Arg-Cys-Glu-Arg-Arg-His-Arg-Gly-Asp-Trp-Gln-Gly-Lys-Gln-Arg-Cys-Leu-Met-Glu-Cys-Arg-Arg-Arg-Glu-Gln-Glu-Glu-Asp (Disulfide bridge: Cys5-Cys27,Cys9-Cys23) Sequence Shortening…
eCATH-1 is an equine-derived antimicrobial peptide. eCATH-1 is significantly effective against both Gram-positive and Gram-negative bacteria. Product Details Product Name eCATH-1 Biological activity eCATH-1 is an antimicrobial peptide derived from horses. eCATH-1 is significantly effective against both Gram-positive and Gram-negative bacteria. Sequence Lys-Arg-Phe-Gly-Arg-Leu-Ala-Lys-Ser-Phe-Leu-Arg-Met-Arg-Ile-Leu-Leu-Pro-Arg-Arg-Lys-Ile-Leu-Leu-Ala-Ser Sequence Shortening KRFGRLAKSFLRMRILLPRRKILLAS Storage Please store the product under the recommended conditions…
Ecnoglutide (XW003) is a long-acting, cAMP-biased glucagon-like peptide 1 (GLP-1) receptor agonist. Ecnoglutide can be used for research of T2DM and obesity. Product Information Product Name Ecnoglutide Molecular Weight 4284.76 Formula C194H304N48O61 CAS Number 2459531-73-6 Appearance Solid Color White to off-white Sequence His-Val-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Arg-Glu-Phe-Ile-Lys-(AEEA-AEEA-{γ-Glu}-C18 diacid)-Trp-Leu-Val-Arg-Gly-Arg-Gly Sequence Shortening HVEGTFTSDVSSYLEEQAAREFIK-(AEEA-AEEA-{γ-Glu}-C18 diacid)-WLVRGRG Storage Sealed storage, away from moisture Powder…
Edotreotide is a ligand that selectively targets SSTR2 and can competitively bind to the receptor. Edotreotide mediates the targeted delivery, while modificated with radionuclides (such as 90Y, 177Lu, and 68Ga) to SSTR-positive tumors and induces tumor cell apoptosis by releasing β rays. Edotreotide has strong tumor targeting and precise killing activity. Edotreotide is used in…
Edratide (TV 4710) is a synthetic peptide of 19 amino acid based on the complementarity-determining region 1 (CDR1) of a human anti-DNA antibody that expresses a major idiotype denoted 16/6 Id. Edratide reduces the rates of apoptosis (Apoptosis) and down-regulates of caspase-8 and caspase-3, up-regulates Bcl-xL. Edratide has the potential for the research of systemic…
Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells, 25 ug (approx. 15 nmol) / peptide for stimulation of 2,5 x 108 cells, 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Controls…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Control Layout: Freeze-dried in glass vial Organism: Other/None Protein Name: Enhanced green fluorescent protein Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK…
Product Name Glucagon-Like Peptide (GLP) II, human Biological activity Glucagon-Like Peptide (GLP) II, human is a 33-amino acid peptide derived from the C-terminal of proglucagon and mainly produced by the intestinal L cells. Glucagon-Like Peptide (GLP) II, human stimulates intestinal mucosal growth and decreases apoptosis of enterocytes . Molecular Weight 3766.2 Formula Formula C165H254N44O55S CAS…
EK1 is a peptide-based coronavirus (CoV) fusion inhibitor with broad-spectrum inhibitory effects against multiple coronaviruses. EK1 shows significantly enhanced pan-coronavirus fusion inhibitory activity. EK1 effectively inhibits SARS-CoV-2. EK1 can form a stable six-helix bundle (6HB) structure with the short ??-hCoV and long ??-hCoV N-terminal heptad repeat sequences. Product Details Product Name EK1 Biological activity EK1…
Product Name Osteocalcin, bovine Biological activity Osteocalcin, bovine is a vitamin K-dependent bone specific protein. Osteocalcin, bovine is also known as bone gamma-carboxyglutamic acid-containing protein (BGLAP). Osteocalcin, bovine is a small (49-amino-acid) noncollagenous protein hormone. Sequence Sequence Tyr-Leu-Asp-His-Trp-Leu-Gly-Ala-Pro-Ala-Pro-Tyr-Pro-Asp-Pro-Leu-{Gla}-Pro-Lys-Arg-{Gla}-Val-Cys-{Gla}-Leu-Asn-Pro-Asp-Cys-Asp-Glu-Leu-Ala-Asp-His-Ile-Gly-Phe-Gln-Glu-Ala-Tyr-Arg-Arg-Phe-Tyr-Gly-Pro-Val (Disulfide bridge:Cys23-Cys29) Sequence Shortening Sequence Shortening YLDHWLGAPAPYPDPL-{Gla}-PKR-{Gla}-VC-{Gla}-LNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:Cys23-Cys29) Storage Please store the product under the recommended…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
