OFFICIAL STATEMENT-Regarding Fraudulent Websites

store

  • CyCMV (TP-UL83)

    CyCMV (TP-UL83)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Infectious mononucleosis Layout: Freeze-dried in glass vial Organism: Cynomolgus macaque cytomegalovirus (CyCMV), Rhesus Cytomegalovirus Protein Name: Tegument protein Purity: >70% (HPLC-MS), Development Grade:…

  • Cynomolgus CMVX Ultra SuperStim Pool

    Cynomolgus CMVX Ultra SuperStim Pool

    Amount: 15 nmol (approx. 25??g) / peptide for stimulation of 2,5 x 108 cells Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Control, Cytomegalovirus disease Layout: Freeze-dried in glass vial Organism: Cynomolgus macaque cytomegalovirus (CyCMV) Protein Name: Selected proteins Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: see…

  • Cys-Arg8 Polyarginine Peptide

    Cys-Arg8 Polyarginine Peptide

    Amount: 1 mg Application: Drug delivery Category: Cell-Penetrating Peptides Condition / Topic: Cancer, Gene therapy Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: CPP Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-CRRRRRRRR-OH

  • Cys-TAT (CGRKKRRQRRRPQ)

    Cys-TAT (CGRKKRRQRRRPQ)

    Amount: 1 mg Application: Drug delivery Category: Cell-Penetrating Peptides Condition / Topic: Cancer, Gene therapy Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: CPP Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-CGRKKRRQRRRPQ-OH

  • Cysteine Peptide

    Cysteine Peptide

    Application: Cosmetics Category: Cosmetic Peptides (DPRA Peptides) Layout: Freeze-dried in plastic vial Purity: >95% (HPLC-MS) Quantification: No Sequence: Ac-RFAACAA-OH Specifications: 9mer peptide as TFA salt

  • D-TAT (47-57) - HIV transactivator

    D-TAT (47-57) – HIV transactivator

    Amount: 1 mg Application: Drug delivery Category: Cell-Penetrating Peptides Condition / Topic: Cancer, Gene therapy Layout: Freeze-dried in plastic vial Organism: Human immunodeficiency virus (HIV) Protein Name: CPP Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-ygrkkrrqrrr-OH

  • D23N-Beta-Amyloid (1-42) HFIP treated

    D23N-Beta-Amyloid (1-42) HFIP treated

    Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVVIA Specifications: Point mutated synthetic Beta-Amyloid peptide (1-42)

  • D7N-Beta-Amyloid (1-42) HFIP treated

    D7N-Beta-Amyloid (1-42) HFIP treated

    Category: Abeta Peptides Condition / Topic: Alzheimer’s disease Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Amyloid beta (A4) protein Purity: >95% (HPLC-MS) Quantification: No Sequence: DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Specifications: Point mutated synthetic Beta-Amyloid peptide (1-42)

  • Dengue 1 (E) Ultra

    Dengue 1 (E) Ultra

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Ultra Peptide Pools Condition / Topic: Dengue fever, Infection, Sequence diversity Layout: Freeze-dried in glass vial Organism: Dengue virus Protein Name: Envelope protein Purity: Development Grade: each peptide purified to…

  • Dengue virus Genome polyprotein 1608-1617, GTSGSPIADK

    Dengue virus Genome polyprotein 1608-1617, GTSGSPIADK

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Dengue fever Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Dengue virus Protein Name: Genome polyprotein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-GTSGSPIADK-OH Specifications: 10mer peptide as TFA salt

  • Dependoparvovirus primate1 Capsid protein VP1 517-525, NSLANPGIA

    Dependoparvovirus primate1 Capsid protein VP1 517-525, NSLANPGIA

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Dependoparvovirus primate1 Protein Name: Capsid protein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-NSLANPGIA-OH Specifications: 9mer peptide as TFA salt

  • Dihydrolipoyllysine acetyltransferase - pyruvate dehydrogenase, GDLIAEVETDKATV

    Dihydrolipoyllysine acetyltransferase – pyruvate dehydrogenase, GDLIAEVETDKATV

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Adenocarcinoma, Breast cancer, Diabetes, Hepatocellular carcinoma, Leukemia, Lung cancer, Lymphoma, Melanoma, Multiple sclerosis, Ovarian cancer Layout: Freeze-dried in glass vial Organism: Human Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-GDLIAEVETDKATV-OH Specifications: 14mer peptide as TFA salt

  • Dodecapeptide AR71, CAS 1247945-70-5

    Dodecapeptide AR71, CAS 1247945-70-5

    Amount: 1 mg Application: Cancer biomarker research Category: Cancer peptides Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Other Purity: >90% (HPLC-MS) Quantification: No Sequence: Ac-FHWRYPLPLPGQ-NH2 Specifications: 12mer cancer peptide

  • DOTA-cyclo(RGDfK) - CAS 909024-55-1

    DOTA-cyclo(RGDfK) – CAS 909024-55-1

    Application: Nuclear medicine Category: Chelate Peptides (DOTA) Condition / Topic: Cancer Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Other Purity: >95% (HPLC-MS) Quantification: No Sequence: RGD-DPhe-Lys(DOTA), head-to-tail cyclized

  • DOTA-NOC (DOTA-[Nal3]-octreotide)

    DOTA-NOC (DOTA-[Nal3]-octreotide)

    Application: Nuclear medicine Category: Chelate Peptides (DOTA) Condition / Topic: Cancer Layout: Freeze-dried in glass vial Organism: Other/None Protein Name: Other Purity: >95% (HPLC-MS) Quantification: No Sequence: DPhe-Cys-1Nal-DTrp-Lys-Thr-Cys-Thr-ol (cyclic disulfide) Specifications: DOTA-NOC (DOTA-[Nal3]-octreotide)

  • DOTA-TATE(DOTA-[Tyr3]-Octreotate)

    DOTA-TATE(DOTA-[Tyr3]-Octreotate)

    Application: Nuclear medicine Category: Chelate Peptides (DOTA) Condition / Topic: Cancer Layout: Freeze-dried in glass vial Organism: Other/None Protein Name: Other Purity: >95% (HPLC-MS) Quantification: No Sequence: DPhe-Cys-Tyr-DTrp-Lys-Thr-Cys-Thr (cyclic disulfide) Specifications: DOTA-TATE(DOTA-[Tyr3]-Octreotate)