Insert HTML here
Showing 2993–3008 of 3705 results
Application: Nuclear medicine Category: Chelate Peptides (DOTA) Condition / Topic: Cancer Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Other Purity: >95% (HPLC-MS) Quantification: No Sequence: NOTA-G-4Abz-QWAVGHLM-NH2 (4Abz = 4-Amino-Benzoic acid Specifications: NOTA-AMBA
NOTA-P2-RM26 is an antagonist of Bombesin (HY-P0195) analogs, and the gastrin-releasing peptide receptor (GRPR/BB2) is a molecular target for prostate cancer visualization. NOTA-P2-RM26 is labeled with 111In and 68Ga for prostate cancer imaging studies using PET and SPECT/CT. Product Information Product Name NOTA-P2-RM26 Molecular Weight 1543.76 Formula C73H110N18O19 CAS Number 1446005-10-2 Appearance Solid Color White…
NP213 is a rapid, novel synthetic antimicrobial peptide (AMP) with antifungal activity. NP213 targets the fungal cytoplasmic membrane and acts through membrane perturbation and disruption. NP213 is effective against onychomycosis and is well tolerated. Product Details Product Name NP213 Biological activity NP213 is a rapidly acting, novel, first-in-class synthetic antimicrobial peptide (AMP), has anti-fungal activities….
NP213 TFA is a rapid, novel synthetic antimicrobial peptide (AMP) with antifungal activity. NP213 TFA targets the fungal cytoplasmic membrane and acts through membrane perturbation and disruption. NP213 is effective against onychomycosis and is well tolerated. Product Details Product Name NP213 TFA Biological activity NP213 TFA is a rapidly acting, novel, first-in-class synthetic antimicrobial peptide…
NPNA hexamer is a peptide. NPNA hexamer can be used for the research of malaria and the development of a sporozoite vaccine. Product Information Product Name NPNA hexamer Molecular Weight 2396.41 Formula C96H146N36O37 CAS Number 114332-71-7 Sequence (Asn-Pro-Asn-Ala)6 Sequence Shortening (NPNA)6
NRC-16 is a biologically active peptide (pleurocidin-like cationic AMP). Product Details Product Name NRC-16 Biological activity NRC-16 is a biological active peptide. (pleurocidin-like cationic AMP) Sequence Gly-Trp-Lys-Lys-Trp-Leu-Arg-Lys-Gly-Ala-Lys-His-Leu-Gly-Gln-Ala-Ala-Ile-Lys-NH2 Sequence Shortening GWKKWLRKGAKHLGQAAIK-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.
NT 13 (TPPT) is a tetrapeptide having the amino acid sequence L-threonyl-L-prolyl-L-prolyl-L-threonine amide. NT 13 is a partial N-methyl-D-aspartate receptor (NMDAR) agonist used in the study of depression, anxiety, and other related diseases. Product Information Product Name NT 13 Molecular Weight 414.45 Formula C18H30N4O7 CAS Number 117928-93-5 Sequence Thr-Pro-Pro-Thr Sequence Shortening TPPT
Product Name NTR 368 TFA Biological activity NTR 368 TFA is a peptide derived from p75 neurotrophin receptor (p75NTR) corresponding to residues 368-381 of the human receptor. NTR 368 TFA has helix forming propensity in the presence of micellar lipid. NTR 368 TFA is a potent inducer of neural apoptosis. Sequence Shortening Sequence Shortening Ac-ATLDALLAALRRIQ-NH2…
Product Name Oxyntomodulin (bovine, porcine) TFA Biological activity Oxyntomodulin (bovine, porcine) TFA, a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist. Sequence Shortening Sequence Shortening HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA Storage Please store the product under the recommended conditions in the Certificate of Analysis.
Nv-CATH is a frog-derived antimicrobial peptide. Nv-CATH has broad-spectrum antibacterial activity against Gram-positive and Gram-negative bacteria. Nv-CATH significantly protects mice from lethal infections caused by Staphylococcus aureus. Nv-CATH protects mice from bacterial infections through the dual properties of antimicrobial and immunomodulatory activity. Product Details Product Name Nv-CATH Biological activity Nv-CATH is an antibacterial peptide of…
Nva-VYIHPF is an analog of Angiotensin II (HY-13948). Product Information Product Name Nva-VYIHPF Molecular Weight 874.04 Formula C45H63N9O9 CAS Number 51988-72-8 Sequence {Nva}-Val-Tyr-Ile-His-Pro-Phe Sequence Shortening {Nva}-VYIHPF
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Adenocarcinoma, Gastric cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Cancer/testis antigen (NY-ESO) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-EAELARRSLAQDAPP-OH Specifications: 15mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Malignant genital cancers Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Cancer/testis antigen (NY-ESO) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-ARRSLAQDAPPLPVP-OH Specifications: 15mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Malignant genital cancers Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Cancer/testis antigen (NY-ESO) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-LAQDAPPLPVPGVLL-OH Specifications: 15mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Malignant genital cancers Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Cancer/testis antigen (NY-ESO) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-APPLPVPGVLLKEFT-OH Specifications: 15mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Malignant genital cancers Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Cancer/testis antigen (NY-ESO) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-PVPGVLLKEFTVSGN-OH Specifications: 15mer peptide as TFA salt
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to store?
WhatsApp Us
Online | Privacy policy
WhatsApp us