Nv-CATH
Description
Nv-CATH is a frog-derived antimicrobial peptide. Nv-CATH has broad-spectrum antibacterial activity against Gram-positive and Gram-negative bacteria. Nv-CATH significantly protects mice from lethal infections caused by Staphylococcus aureus. Nv-CATH protects mice from bacterial infections through the dual properties of antimicrobial and immunomodulatory activity.
Product Details
| Product Name | Nv-CATH |
| Biological activity | Nv-CATH is an antibacterial peptide of frog origin. Nv-CATH has broad-spectrum antibacterial activity against gram-positive and gram-negative bacteria. Nv-CATH significantly protects mice from fatal infections caused by Staphylococcus aureus. Nv-CATH protects mice from bacterial infection through antimicrobial immunoregulatory duality. |
| Sequence Shortening | NCNFLCKVKQRLRSVSSTSHIGMAIPRPRG |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
