Product Name pTH (2-34) (human) Biological activity pTH (2-34) (human) (80 ??g/kg) slightly increases serum osteocalcin levels and alkaline phosphatase activity of bone extract (markers of bone formation) in mice. pTH (2-34) is not as effective as pTH (1-34). CAS Number 247902-18-7 Sequence Sequence Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe Sequence Shortening Sequence Shortening VSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF Storage Please store the product…
Product Name human GIP(3-30), amide TFA Biological activity Human GIP(3-30), amide TFA is the TFA salt form of human GIP(3-30), amide (HY-P10138). Human GIP(3-30), amide TFA is a high affinity antagonist of the human GIP receptor in vitro. Human GIP(3-30), amide TFA has potential anti-obesity and anti-diabetic effects. Formula Formula C150H226N38O44S.xC2HF3O2 Appearance Solid Color White…
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Immunogenic Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Ankyrin repeat domain-containing protein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-ALNSEALSVV-OH Specifications: 10mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Leukemia Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Heat shock protein Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-KEKYIDQEEL-OH Specifications: 10mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Prostate cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Putative N-acetylated-alpha-linked acidic dipeptidase Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-MMNDQLMFL-OH Specifications: 9mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Adenocarcinoma, Prostate cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Putative N-acetylated-alpha-linked acidic dipeptidase Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-ALFDIESKV-OH Specifications: 9mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: RalBP1-associated Eps domain-containing protein 1 Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-AQLANDVVL-OH WT Sequence: AQLPNDVVL Specifications: 9mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Breast cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: RecQ-like DNA helicase BLM Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-EEIPVSSHYF-OH Specifications: 10mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Leukemia Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Replication factor Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-YLSKIIPAL-OH Specifications: 9mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Autoimmune disease Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Retinol-binding protein 3 Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-SGIPYIISYLHPGNTILHVD-OH Specifications: 20mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Leukemia Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: RNA binding motif protein X-linked Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-SLDGKAIKV-OH Specifications: 9mer peptide as TFA salt
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager
