OFFICIAL STATEMENT-Regarding Fraudulent Websites

store

  • Human Prostatic acid phosphatase 129-143, VSIWNPILLWQPIPV

    Human Prostatic acid phosphatase 129-143, VSIWNPILLWQPIPV

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Prostate cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Prostatic acid phosphatase (PAP) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-VSIWNPILLWQPIPV-OH Specifications: 15mer peptide as TFA salt

    Read moreDone
  • Human Prostatic acid phosphatase 135-143, ILLWQPIPV

    Human Prostatic acid phosphatase 135-143, ILLWQPIPV

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Prostate cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Prostatic acid phosphatase (PAP) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-ILLWQPIPV-OH Specifications: 9mer peptide as TFA salt

    Read moreDone
  • Human Prostatic acid phosphatase 161-175, CPRFQELESETLKSE

    Human Prostatic acid phosphatase 161-175, CPRFQELESETLKSE

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Prostate cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Prostatic acid phosphatase (PAP) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-CPRFQELESETLKSE-OH Specifications: 15mer peptide as TFA salt

    Read moreDone
  • Human Prostatic acid phosphatase 181-195, LHPYKDFIATLGKLS

    Human Prostatic acid phosphatase 181-195, LHPYKDFIATLGKLS

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Prostate cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Prostatic acid phosphatase (PAP) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-LHPYKDFIATLGKLS-OH Specifications: 15mer peptide as TFA salt

    Read moreDone
  • Human Prostatic acid phosphatase 201-215, DLFGIWSKVYDPLYC

    Human Prostatic acid phosphatase 201-215, DLFGIWSKVYDPLYC

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Prostate cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Prostatic acid phosphatase (PAP) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-DLFGIWSKVYDPLYC-OH Specifications: 15mer peptide as TFA salt

    Read moreDone
  • Human Prostatic acid phosphatase 237-251, ELSELSLLSLYGIHK

    Human Prostatic acid phosphatase 237-251, ELSELSLLSLYGIHK

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Prostate cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Prostatic acid phosphatase (PAP) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-ELSELSLLSLYGIHK-OH Specifications: 15mer peptide as TFA salt

    Read moreDone
  • Human Prostatic acid phosphatase 299-307, ALDVYNGLL

    Human Prostatic acid phosphatase 299-307, ALDVYNGLL

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Prostate cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Prostatic acid phosphatase (PAP) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-ALDVYNGLL-OH Specifications: 9mer peptide as TFA salt

    Read moreDone
  • Human Prostatic acid phosphatase 45-59, GDRSPIDTFPTDPIK

    Human Prostatic acid phosphatase 45-59, GDRSPIDTFPTDPIK

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Prostate cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Prostatic acid phosphatase (PAP) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-GDRSPIDTFPTDPIK-OH Specifications: 15mer peptide as TFA salt

    Read moreDone
  • Human Prostatic acid phosphatase 81-95, LGEYIRKRYRKFLNE

    Human Prostatic acid phosphatase 81-95, LGEYIRKRYRKFLNE

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Prostate cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Prostatic acid phosphatase (PAP) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-LGEYIRKRYRKFLNE-OH Specifications: 15mer peptide as TFA salt

    Read moreDone
  • Human Protein AATF 527-534, MAPIDHTTM

    Human Protein AATF 527-534, MAPIDHTTM

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Immunogenic Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-MAPIDHTTM-OH Specifications: 9mer peptide as TFA salt

    Read moreDone
  • Human Protein BTG1 103-111, TLWVDPYEV

    Human Protein BTG1 103-111, TLWVDPYEV

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Cancer, Leukemia Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-TLWVDPYEV-OH Specifications: 9mer peptide as TFA salt

    Read moreDone
  • Human Protein SSX2 103-111, RLQGISPKI

    Human Protein SSX2 103-111, RLQGISPKI

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Hepatocellular carcinoma, Prostate cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-RLQGISPKI-OH Specifications: 9mer peptide as TFA salt

    Read moreDone
  • Human Protein SSX2 41-49, KASEKIFYV

    Human Protein SSX2 41-49, KASEKIFYV

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Cancer, Hepatitis, Hepatocellular carcinoma, Melanoma, Prostate cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-KASEKIFYV-OH Specifications: 9mer peptide as TFA salt

    Read moreDone
  • Human Protein SSX2 45-59, KIFYVYMKRKYEAMT

    Human Protein SSX2 45-59, KIFYVYMKRKYEAMT

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Breast cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-KIFYVYMKRKYEAMT-OH Specifications: 15mer peptide as TFA salt

    Read moreDone
  • Human Protein-serine O-palmitoleoyltransferase porcupine 339-347, LLHGFSFYL

    Human Protein-serine O-palmitoleoyltransferase porcupine 339-347, LLHGFSFYL

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Melanoma Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Protein-serine O-palmitoleoyltransferase porcupine Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-LLHGFSFYL-OH WT Sequence: LLHGFSFHL Specifications: 9mer peptide as TFA salt

    Read moreDone
  • Human PTH-(1-31)

    Human PTH-(1-31)

    Product Name Human PTH-(1-31) amide Biological activity Human PTH-(1-31) amide is a PTH analog. Human PTH-(1-31) amide stimulate phosphatidylcholine hydrolysis and stimulates adenylyl cyclase release. CAS Number 173833-08-4 Sequence Sequence Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-NH2 Sequence Shortening Sequence Shortening SVSEIQLMHNGKHLNSMERVEWLRKKLQDV-NH2 Storage Please store the product under the recommended conditions in the Certificate of Analysis.

    Read moreDone