OFFICIAL STATEMENT-Regarding Fraudulent Websites

peptides

  • HTLV-1 (strain Japan ATK-1 subtype A) Basic zipper factor 45-52, AVLDGLLSL

    HTLV-1 (strain Japan ATK-1 subtype A) Basic zipper factor 45-52, AVLDGLLSL

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human T-cell leukemia virus (HTLV-1) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-AVLDGLLSL-OH Specifications: 9mer peptide as TFA salt

  • HTLV-1 (strain Japan ATK-1 subtype A) Tax-1  301-309, SFHSLHLLF

    HTLV-1 (strain Japan ATK-1 subtype A) Tax-1 301-309, SFHSLHLLF

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human T-cell leukemia virus (HTLV-1) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-SFHSLHLLF-OH Specifications: 9mer peptide as TFA salt

  • HTLV-1 (TAX)

    HTLV-1 (TAX)

    Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Infection Layout: Freeze-dried in glass vial Organism: Human T-cell leukemia virus (HTLV-1) Protein Name: Tax-1 Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence:…

  • Human (Actin)

    Human (Actin)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Controls Condition / Topic: Control Layout: Freeze-dried in glass vial Organism: Human Protein Name: Actin Purity: >70% (HPLC-MS), Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification:…

  • Human (ACTL8)

    Human (ACTL8)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer, Epithelium Layout: Freeze-dried in glass vial Organism: Human Protein Name: Actin Purity: >70% (HPLC-MS), Development Grade: each peptide purified to…

  • Human (AFP)

    Human (AFP)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer Layout: Freeze-dried in glass vial Organism: Human Protein Name: Alpha-fetoprotein Purity: >70% (HPLC-MS), Development Grade: each peptide purified to >…

  • Human (Alpha-Synuclein)

    Human (Alpha-Synuclein)

    Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Alzheimer’s disease, Neurodegeneration Layout: Freeze-dried in glass vial Organism: Human Protein Name: Alpha-Synuclein Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA Specifications:…

  • Human (Aquaporin-4)

    Human (Aquaporin-4)

    Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Alzheimer’s disease, Autoimmune disease, Cancer, Neurodegeneration Layout: Freeze-dried in glass vial Organism: Human Protein Name: Aquaporin-4 Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No…

  • Human (Brachyury)

    Human (Brachyury)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Brachyury Mutation, Cancer Layout: Freeze-dried in glass vial Organism: Human Protein Name: Transcription factors/activators Purity: >70% (HPLC-MS), Development Grade: each peptide…

  • Human (BRAF)

    Human (BRAF)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer Layout: Freeze-dried in glass vial Organism: Human Protein Name: Serine/threonine-protein kinase B-raf Purity: >70% (HPLC-MS), Development Grade: each peptide purified…

  • Human (CEA)

    Human (CEA)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer, Epithelium Layout: Freeze-dried in glass vial Organism: Human Protein Name: Carcinoembryonic antigen-related cell adhesion molecule 5 Purity: >70% (HPLC-MS), Development…

  • Human (CF VIII C-terminal)

    Human (CF VIII C-terminal)

    Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Blood coagulation Layout: Freeze-dried in glass vial Organism: Human Protein Name: Coagulation factor VIII Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: F5/8…

  • Human (CF VIII N-terminal)

    Human (CF VIII N-terminal)

    Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Blood coagulation Layout: Freeze-dried in glass vial Organism: Human Protein Name: Coagulation factor VIII Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: F5/8…

  • Human (CFTR)

    Human (CFTR)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Cystic Fibrosis, Epithelium, Respiratory infection Layout: Freeze-dried in 2 glass vials Organism: Human Protein Name: Cystic fibrosis transmembrane conductance regulator Purity: Development Grade: each peptide purified to >…

  • Human (Claudin-6)

    Human (Claudin-6)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer, Epithelium Layout: Freeze-dried in glass vial Organism: Human Protein Name: Claudin-6 Purity: >70% (HPLC-MS), Development Grade: each peptide purified to…

  • Human (CTLA4)

    Human (CTLA4)

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer, Immune checkpoint Layout: Freeze-dried in glass vial Organism: Human Protein Name: Cytotoxic T-lymphocyte protein Purity: >70% (HPLC-MS), Development Grade: each…