Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Neurodegeneration Layout: Freeze-dried in glass vial Organism: Human Protein Name: Myelin basic protein Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR Specifications:…
Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Autoimmune disease Layout: Freeze-dried in glass vial Organism: Human Protein Name: Myelin basic protein Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools other Antigens Condition / Topic: Microcephaly Layout: Freeze-dried in glass vial Organism: Human Protein Name: Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase Purity: >70% (HPLC-MS), Development Grade: each peptide purified to > 70%…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer, Prostate cancer Layout: Freeze-dried in glass vial Organism: Human Protein Name: Homeobox protein Nkx-3.1 Purity: >70% (HPLC-MS), Development Grade: each…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer Layout: Freeze-dried in glass vial Organism: Human Protein Name: Cellular tumor antigen p53 Purity: >70% (HPLC-MS), Development Grade: each peptide…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer Layout: Freeze-dried in glass vial Organism: Human Protein Name: Placenta-specific protein 1 Purity: >70% (HPLC-MS), Development Grade: each peptide purified…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools TAA Condition / Topic: Cancer, Prostate cancer Layout: Freeze-dried in glass vial Organism: Human Protein Name: Prostate-specific antigen Purity: >70% (HPLC-MS), Development Grade: each peptide…
Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Prostate cancer Layout: Freeze-dried in glass vial Organism: Human Protein Name: Prostate stem cell antigen Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence:…
Contains information related to marketing campaigns of the user. These are shared with Google AdWords / Google Ads when the Google Ads and Google Analytics accounts are linked together.
90 days
__utma
ID used to identify users and sessions
2 years after last activity
__utmt
Used to monitor number of Google Analytics server requests
10 minutes
__utmb
Used to distinguish new sessions and visits. This cookie is set when the GA.js javascript library is loaded and there is no existing __utmb cookie. The cookie is updated every time data is sent to the Google Analytics server.
30 minutes after last activity
__utmc
Used only with old Urchin versions of Google Analytics and not with GA.js. Was used to distinguish between new sessions and visits at the end of a session.
End of session (browser)
__utmz
Contains information about the traffic source or campaign that directed user to the website. The cookie is set when the GA.js javascript is loaded and updated when data is sent to the Google Anaytics server
6 months after last activity
__utmv
Contains custom information set by the web developer via the _setCustomVar method in Google Analytics. This cookie is updated every time new data is sent to the Google Analytics server.
2 years after last activity
__utmx
Used to determine whether a user is included in an A / B or Multivariate test.
18 months
_ga
ID used to identify users
2 years
_gali
Used by Google Analytics to determine which links on a page are being clicked
30 seconds
_ga_
ID used to identify users
2 years
_gid
ID used to identify users for 24 hours after last activity
24 hours
_gat
Used to monitor number of Google Analytics server requests when using Google Tag Manager