peptides

  • EFX Ultra SuperStim Pool

    EFX Ultra SuperStim Pool

    Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Controls Condition / Topic: Control Layout: Freeze-dried in glass vial Organism: Other/None Protein Name: Selected proteins Quantification: No Sequence: see additional product documentation Specifications: Defined HLA class I-restricted T-cell epitopes

  • eGFP

    eGFP

    Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Control Layout: Freeze-dried in glass vial Organism: Other/None Protein Name: Enhanced green fluorescent protein Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK…

  • EPEA Tag - C-tag - Biotin-EPEA

    EPEA Tag – C-tag – Biotin-EPEA

    Amount: 5 mg Application: B-cell Immunity, Cancer biomarker research, T-cell immunity Category: Affinity Tag Peptides Condition / Topic: Cancer Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Affinity tag Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: Biotin-EPEA-OH

  • EPEA Tag - C-tag - EPEA

    EPEA Tag – C-tag – EPEA

    Amount: 5 mg Application: B-cell Immunity, Cancer biomarker research, T-cell immunity Category: Affinity Tag Peptides Condition / Topic: Cancer Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Affinity tag Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-SEPEA-OH

  • Epinecidin-1 Peptide

    Epinecidin-1 Peptide

    Amount: 0.5 mg Application: Proteomics Category: Antimicrobial Peptides Condition / Topic: Antimicrobial Layout: Freeze-dried in plastic vial Modification: None Organism: Fish Protein Name: epinecidin-1 prepropeptide Purity: >95% (HPLC-MS) Quantification: No Sequence: H-GFIFHIIKGLFHAGKMIHGLV-OH Specifications: Antimicrobial peptide

  • Epitope Mapping Peptide Set (EMPS) HCoV-229E (Spike Glycoprotein)

    Epitope Mapping Peptide Set (EMPS) HCoV-229E (Spike Glycoprotein)

    Amount: 5 μg / peptide as individual peptide and in matrix pools Application: T-cell immunity Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools Condition / Topic: Common cold, Covid-19, Infection, Respiratory infection Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 5 x 96 tube racks Organism: Human coronavirus (HCoV) Protein Name: Spike glycoprotein…

  • Epitope Mapping Peptide Set (EMPS) HCoV-HKU1 (Spike Glycoprotein)

    Epitope Mapping Peptide Set (EMPS) HCoV-HKU1 (Spike Glycoprotein)

    Amount: 5 μg / peptide as individual peptide and in matrix pools Application: T-cell immunity Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools Condition / Topic: Common cold, Covid-19, Infection, Respiratory infection Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 5 x 96 tube racks Organism: Human coronavirus (HCoV) Protein Name: Spike glycoprotein…

  • Epitope Mapping Peptide Set (EMPS) HCoV-NL63 (Spike Glycoprotein)

    Epitope Mapping Peptide Set (EMPS) HCoV-NL63 (Spike Glycoprotein)

    Amount: 5 μg / peptide as individual peptide and in matrix pools Application: T-cell immunity Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools Condition / Topic: Common cold, Covid-19, Infection, Respiratory infection Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 5 x 96 tube racks Organism: Human coronavirus (HCoV) Protein Name: Spike glycoprotein…

  • Epitope Mapping Peptide Set (EMPS) HCoV-OC43 (Spike Glycoprotein)

    Epitope Mapping Peptide Set (EMPS) HCoV-OC43 (Spike Glycoprotein)

    Amount: 5 μg / peptide as individual peptide and in matrix pools Application: T-cell immunity Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools Condition / Topic: Common cold, Covid-19, Infection, Respiratory infection Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 5 x 96 tube racks Organism: Human coronavirus (HCoV) Protein Name: Spike glycoprotein…

  • Epitope Mapping Peptide Set (EMPS) MERS-CoV (Spike Glycoprotein)

    Epitope Mapping Peptide Set (EMPS) MERS-CoV (Spike Glycoprotein)

    Amount: 5 μg / peptide as individual peptide and in matrix pools Application: T-cell immunity Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools Condition / Topic: Covid-19, Infection, Middle Eastern Respiratory Syndrome (MERS), Respiratory infection Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 5 x 96 tube racks Organism: MERS-CoV (Middle East respiratory…

  • Epitope Mapping Peptide Set (EMPS) SARS-CoV (Spike Glycoprotein)

    Epitope Mapping Peptide Set (EMPS) SARS-CoV (Spike Glycoprotein)

    Amount: 5 μg / peptide as individual peptide and in matrix pools Application: T-cell immunity Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools Condition / Topic: Covid-19, Infection, Respiratory infection Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 5 x 96 tube racks Organism: SARS-CoV (Severe acute respiratory syndrome coronavirus) Protein Name: Spike…

  • Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (NCAP)

    Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (NCAP)

    Amount: 5 μg / peptide as individual peptide and in matrix pools Application: T-cell immunity Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools Condition / Topic: Covid-19, Infection, Respiratory infection Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 3 x 96 tube racks Organism: SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) Protein Name:…

  • Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (Spike Glycoprotein)

    Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (Spike Glycoprotein)

    Amount: 5 μg / peptide as individual peptide and in matrix pools Application: T-cell immunity Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools Condition / Topic: Covid-19, Infection, Respiratory infection Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 5 x 96 tube racks Organism: SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) Protein Name:…

  • Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)

    Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)

    Amount: 5 μg / peptide as individual peptide and in matrix pools Application: T-cell immunity Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools Condition / Topic: Covid-19, Infection, Respiratory infection Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 2 x 96 tube racks Organism: SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) Protein Name:…

  • Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VME1)

    Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VME1)

    Amount: 5 μg / peptide as individual peptide and in matrix pools Application: T-cell immunity Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools Condition / Topic: Covid-19, Infection, Respiratory infection Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 2 x 96 tube racks Organism: SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) Protein Name:…

  • Escherichia coli Beta-galactosidase 1  103-109, DAPIYTNV

    Escherichia coli Beta-galactosidase 1 103-109, DAPIYTNV

    Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Infection Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Escherichia coli Protein Name: Beta-galactosidase Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-DAPIYTNV-OH Specifications: 8mer peptide as TFA salt