OFFICIAL STATEMENT-Regarding Fraudulent Websites

Epitope Mapping Peptide Set (EMPS) SARS-CoV-2 (VEMP)

Category:

Description

Amount: 5 μg / peptide as individual peptide and in matrix pools
Application: T-cell immunity
Category: Epitope Mapping Peptide Sets, PepMix Peptide Pools
Condition / Topic: Covid-19, Infection, Respiratory infection
Layout: Freeze-dried in 1 x 96 tube rack, Freeze-dried in 2 x 96 tube racks
Organism: SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2)
Protein Name: Envelope protein
Purity: Research Plus Grade: each peptide is guaranteed to be main product (HPLC/MS), crude (major peak by LC-MS is guaranteed to be peptide of interest for each peptide)
Quantification: No

Sequence:

MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV

Specifications:

Peptide scan (optimized scan into 15 mers)