Showing 577–592 of 638 results
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Fever, Hemorrhagic fever, Infection, Lassa fever Layout: Freeze-dried in glass vial Organism: Lassa virus Protein Name: Pre-glycoprotein polyprotein GP complex Purity: >70% (HPLC-MS), Development…
Amount: 0.5 mg Application: Proteomics Category: Antimicrobial Peptides Condition / Topic: Antimicrobial Layout: Freeze-dried in plastic vial Modification: None Organism: Human Purity: >95% (HPLC-MS) Quantification: No Sequence: H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OH Specifications: Antimicrobial peptide
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Lymphocytic choriomeningitis, Meningitis Layout: Freeze-dried in glass vial Organism: Lymphocytic choriomeningitis virus Protein Name: Membrane protein, Nucleocapsid protein Purity: >70% (HPLC-MS), Development Grade:…
Application: Cosmetics Category: Cosmetic Peptides (DPRA Peptides) Layout: Freeze-dried in plastic vial Purity: >95% (HPLC-MS) Quantification: No Sequence: Ac-RFAAKAA-OH Specifications: 9mer peptide as TFA salt
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Opportunistic infections, Respiratory infection, Tuberculosis Layout: Freeze-dried in glass vial Organism: M. tuberculosis Protein Name: Alpha-crystallin Purity: >70% (HPLC-MS), Development…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Opportunistic infections, Respiratory infection, Tuberculosis Layout: Freeze-dried in glass vial Organism: M. tuberculosis Protein Name: Diacylglycerol acyltransferase/mycolyltransferase Purity: Development Grade: each peptide purified…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Opportunistic infections, Respiratory infection, Tuberculosis Layout: Freeze-dried in glass vial Organism: M. tuberculosis Protein Name: Diacylglycerol acyltransferase/mycolyltransferase Purity: >70% (HPLC-MS), Development Grade: each…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Opportunistic infections, Respiratory infection, Tuberculosis Layout: Freeze-dried in glass vial Organism: M. tuberculosis Protein Name: Antitoxin Purity: Development Grade: each peptide purified to…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Opportunistic infections, Respiratory infection, Tuberculosis Layout: Freeze-dried in glass vial Organism: M. tuberculosis Protein Name: ESAT-6-like protein Purity: >70% (HPLC-MS), Development Grade: each…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Opportunistic infections, Respiratory infection, Tuberculosis Layout: Freeze-dried in glass vial Organism: M. tuberculosis Protein Name: ESAT-6 Purity: >70% (HPLC-MS), Development Grade: each peptide…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Opportunistic infections, Respiratory infection, Tuberculosis Layout: Freeze-dried in glass vial Organism: M. tuberculosis Protein Name: Diacylglycerol acyltransferase/mycolyltransferase, ESX-1 secretion-associated protein EspA Purity: >70%…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Opportunistic infections, Respiratory infection, Tuberculosis Layout: Freeze-dried in glass vial Organism: M. tuberculosis Protein Name: ESAT-6-like protein Purity: >70% (HPLC-MS), Development Grade: each…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Opportunistic infections, Respiratory infection, Tuberculosis Layout: Freeze-dried in glass vial Organism: M. tuberculosis Protein Name: Heparin-binding hemagglutinin Purity: Development Grade: each peptide purified…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: Cancer biomarker research, T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Opportunistic infections, Respiratory infection, Tuberculosis Layout: Freeze-dried in glass vial Organism: M. tuberculosis Protein Name: Hypoxic response protein 1 Purity:…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Opportunistic infections, Respiratory infection, Tuberculosis Layout: Freeze-dried in glass vial Organism: M. tuberculosis Protein Name: Immunogenic protein MPT64 Purity: >70% (HPLC-MS), Development Grade:…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Infection, Opportunistic infections, Respiratory infection, Tuberculosis Layout: Freeze-dried in glass vial Organism: M. tuberculosis Protein Name: PPE family immunomodulator PPE68 Purity: >70% (HPLC-MS), Development…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to peptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us
