LEAP-2
Description
LEAP-2 (Human liver expressed antimicrobial peptide-2) is a GHS-R1a antagonist with an IC50 value of 6.0 nM. LEAP-2 inhibits the orexigenic effects of ghrelin. LEAP-2 attenuates ghrelin-induced growth hormone (GH) release and reduces basal food intake. LEAP-2 exhibits antibacterial activity against microbial model strains. LEAP-2 can be used in research on obesity and infection.
Product Details
| Product Name | LEAP-2 |
| Biological activity | LEAP-2 (Human liver expressed antimicrobial peptide-2) is a GHS-R1a antagonist, with an IC50 of 6.0 nM. LEAP-2 suppresses the orexigenic effect of ghrelin. LEAP-2 attenuates ghrelin-induced growth hormone (GH) release and reduces basal food intake. LEAP-2 exhibits antimicrobial activity against microbial model organisms. LEAP-2 can be used for the study of obesity and infection. |
| Molecular Weight | 4581.27 |
| Formula | C191H316N64O57S5 |
| CAS Number | 1683582-94-6 |
| Appearance | Solid |
| Color | White to off-white |
| Sequence | Met-Thr-Pro-Phe-Trp-Arg-Gly-Val-Ser-Leu-Arg-Pro-Ile-Gly-Ala-Ser-Cys-Arg-Asp-Asp-Ser-Glu-Cys-Ile-Thr-Arg-Leu-Cys-Arg-Lys-Arg-Arg-Cys-Ser-Leu-Ser-Val-Ala-Gln-Glu (Disulfide bridge:Cys17-Cys28;Cys23-Cys33) |
| Sequence Shortening | MTPFWRGVSLRPIGASCRDDSECITRLCRKRRCSLSVAQE (Disulfide bridge:Cys17-Cys28;Cys23-Cys33) |
