DN59
Description
DN59 is a 33-amino-acid peptide that mimics the stem region of the dengue virus type 2 E protein. DN59 inhibits all four serotypes of dengue virus (IC50: 2-5 ??M) as well as other flaviviruses. DN59 acts by directly interacting with viral particles, leading to the release of genomic RNA. DN59 has antiviral activity.
Product Details
| Product Name | DN59 |
| Biological activity | DN59 is a 33 amino acid peptide that mimics the dengue virus type 2 E stem region. DN59 inhibits all four serotypes of dengue virus (IC50: 2-5 ??M) as well as other flaviviruses. N59 causes the release of genomic RNA by interacting directly with viral particles. DN59 has antiviral activity. |
| Appearance | Solid |
| Color | White to off-white |
| Sequence | Met-Ala-Ile-Leu-Gly-Asp-Thr-Ala-Trp-Asp-Phe-Gly-Ser-Leu-Gly-Gly-Val-Phe-Thr-Ser-Ile-Gly-Lys-Ala-Leu-His-Gln-Val-Phe-Gly-Ala-Ile-Tyr |
| Sequence Shortening | MAILGDTAWDFGSLGGVFTSIGKALHQVFGAIY |
| Storage | Sealed storage, away from moisture |
