Diptericin
Description
Diptericin is an antimicrobial peptide originally isolated from the blow fly Phormia terranovae. Diptericin has potent and selective inhibitory activity against certain Gram-negative bacteria, such as Escherichia coli and Salmonella typhimurium. Diptericin rapidly kills bacteria within 1 hour. Diptericin can be used in antimicrobial research.
Product Details
| Product Name | Diptericin |
| Biological activity | Diptericin is an antibacterial peptide, originally isolated from Phormia terranovae. Diptericin exhibits potent and selective activity against specific Gram-negative bacteria, such as Escherichia coli and Salmonella typhimurium. Diptericin kills bacteria within 1 hour. Diptericin can be used for antibacterial research. |
| Sequence Shortening | DLHIPPPDNKINWPQLSGGGGGSPKTGYDININAQQK |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
