Defensin HNP-1 human TFA
Description
Defensin HNP-1 human TFA is a human neutrophil peptide (HNP). Defensin HNP-1 human TFA has immunomodulatory functions and delays neutrophil apoptosis. Defensin HNP-1 human TFA has broad-spectrum antibacterial activity by inhibiting DNA/RNA/protein synthesis and interfering with metabolic pathways. Defensin HNP-1 human TFA has direct inactivating effects on HIV, HSV-1, HSV-2, CMV, influenza virus, and others. Defensin HNP-1 human TFA has anti-leishmanial activity. Defensin HNP-1 human TFA is involved in endothelial cell dysfunction during the development of early atherosclerosis.
Product Details
| Product Name | Defensin HNP-1 human TFA |
| Biological activity | Defensin HNP-1 human TFA is a type of human neutrophil peptide (HNPs). Defensin HNP-1 human TFA possesses immunomodulatory functions and can delay the apoptosis of neutrophils. Defensin HNP-1 human TFA inhibits DNA/RNA/protein synthesis and interferes with metabolic pathways, thus exhibiting broad antibacterial activity. Defensin HNP-1 human TFA has direct inactivation effects on HIV, HSV-1, HSV-2, CMV, influenza virus, etc. Defensin HNP-1 human TFA has antileishmanial activity. Defensin HNP-1 human TFA is involved in endothelial cell dysfunction during the early development of atherosclerosis. |
| Molecular Weight | 4012.15 |
| Formula | C160H227F15N44O48S6 |
| Appearance | Solid |
| Color | White to off-white |
| Sequence | Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29) |
| Sequence Shortening | ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge:Cys2-Cys30,Cys4-Cys19,Cys9-Cys29) |
| Storage | Sealed storage, away from moisture |
