Showing 369–384 of 1666 results
Amount: 0.5 mg Application: Proteomics Category: Antimicrobial Peptides Condition / Topic: Antimicrobial Layout: Freeze-dried in plastic vial Modification: None Organism: Insect Protein Name: Cecropin Purity: >95% (HPLC-MS) Quantification: No Sequence: H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 Specifications: Antimicrobial peptide
Amount: 0.5 mg Application: Cancer biomarker research Category: Cancer peptides Layout: Freeze-dried in plastic vial Organism: Hyalophora Protein Name: Cecropin Purity: >90% (HPLC-MS) Quantification: No Sequence: H-KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 Specifications: 37mer cancer peptide
Amount: 0.5 mg Application: Cancer biomarker research Category: Cancer peptides Layout: Freeze-dried in plastic vial Organism: Hyalophora Protein Name: Cecropin Purity: >90% (HPLC-MS) Quantification: No Sequence: H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 Specifications: 35mer cancer peptide
Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Controls Condition / Topic: Control, Cytomegalovirus disease, Flu-like disease, Infectious mononucleosis, Influenza Layout: Freeze-dried in glass vial Organism: Epstein-Barr Virus (EBV), Human Cytomegalovirus (HCMV), Influenza A Protein Name: Selected proteins Quantification:…
Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Controls Condition / Topic: Control, Cytomegalovirus disease, Flu-like disease, Infectious mononucleosis, Influenza Layout: Freeze-dried in glass vial Organism: Epstein-Barr Virus (EBV), Human Cytomegalovirus (HCMV), Influenza A Protein Name: Selected proteins Quantification:…
Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Control Layout: Freeze-dried in glass vial Organism: Clostridium tetani, Coxsackievirus, Haemophilus influenzae, Helicobacter pylori, Herpes Simplex Virus, Human Adenovirus (HAdV), Human Papillomavirus (HPV), Human herpesvirus 6 (HHV6), Influenza A, JC polyomavirus,…
Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Controls Condition / Topic: Control, Cytomegalovirus disease, Flu-like disease, Infectious mononucleosis, Influenza, Tetanus Layout: Freeze-dried in glass vial Organism: Clostridium tetani, Epstein-Barr Virus (EBV), Human Cytomegalovirus (HCMV), Influenza A Protein Name:…
Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Control, Cytomegalovirus disease, Flu-like disease, Infectious mononucleosis, Influenza, Tetanus Layout: Freeze-dried in glass vial Organism: Clostridium tetani, Epstein-Barr Virus (EBV), Human Cytomegalovirus (HCMV), Influenza A Protein Name: Selected proteins Quantification: No Sequence: see additional product documentation Specifications: Defined HLA class I & II-restricted T-cell epitopes
Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Control Layout: Freeze-dried in glass vial Organism: Other/None Protein Name: Selected proteins Quantification: No Sequence: see additional product documentation Specifications: Defined HLA restricted T-cell epitopes
Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Controls Condition / Topic: Control Layout: Freeze-dried in glass vial Organism: Other/None Protein Name: Other, Selected proteins Purity: >70% (HPLC-MS), Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No…
Amount: 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Controls Condition / Topic: Control Layout: Freeze-dried in glass vial Organism: Other/None Protein Name: Other, Selected proteins Purity: >70% (HPLC-MS), Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No…
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Adenocarcinoma, Arthritis, Diabetes, Leukemia, Lyme disease, Lymphoma, Multiple sclerosis Layout: Freeze-dried in glass vial Organism: Escherichia coli Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-QKRAAYDQYGHAAFE-OH Specifications: 15mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Arthritis Layout: Freeze-dried in glass vial Organism: M. tuberculosis Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-TFGLQLELT-OH Specifications: 9mer peptide as TFA salt
Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Chikungunya fever, Infection Layout: Freeze-dried in glass vial Organism: Chikungunya virus Protein Name: Spike glycoprotein Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence:…
Amount: 25 ??g (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools Condition / Topic: Chikungunya fever Layout: Freeze-dried in glass vial Organism: Chikungunya virus Protein Name: Spike glycoprotein Purity: Development Grade: each peptide purified to > 70% (HPLC/MS) Quantification: No Sequence: see…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Peptide Pools Infections Condition / Topic: Cancer, Gene therapy, Infection Layout: Freeze-dried in glass vial Organism: Chimpanzee Adenovirus (ChAd) Protein Name: Hexon protein Purity: Research Plus Grade: each peptide is…
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to peptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us
