Showing 1617–1632 of 1666 results
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Adenocarcinoma, Gastric cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Cancer/testis antigen (NY-ESO) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-PGIPDGPGGNAGGPG-OH Specifications: 15mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Adenocarcinoma, Gastric cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Cancer/testis antigen (NY-ESO) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-DGPGGNAGGPGEAGA-OH Specifications: 15mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Malignant genital cancers Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Cancer/testis antigen (NY-ESO) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-GNAGGPGEAGATGGR-OH Specifications: 15mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Malignant genital cancers Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Cancer/testis antigen (NY-ESO) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-GPGEAGATGGRGPRG-OH Specifications: 15mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Malignant genital cancers Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Cancer/testis antigen (NY-ESO) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-AGATGGRGPRGAGAA-OH Specifications: 15mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Adenocarcinoma, Gastric cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Cancer/testis antigen (NY-ESO) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-GGRGPRGAGAARASG-OH Specifications: 15mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Malignant genital cancers Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Cancer/testis antigen (NY-ESO) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-GRGTGGSTGDADGPG-OH Specifications: 15mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Adenocarcinoma, Gastric cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Cancer/testis antigen (NY-ESO) Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-GGSTGDADGPGGPGI-OH Specifications: 15mer peptide as TFA salt
Amount: 5 mg Application: Cancer biomarker research, T-cell immunity Category: Affinity Tag Peptides Condition / Topic: Cancer Layout: Freeze-dried in plastic vial Organism: Artificial Protein Name: Affinity tag Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-MDYKDHDGDYKDHDIDYKDDDDK-OH Specifications:
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Breast cancer Layout: Freeze-dried in glass vial, Freeze-dried in plastic vial Organism: Human Protein Name: Histones Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-ALKRQGRTLYGFGG-OH Specifications: 14mer peptide as TFA salt
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Control, Infectious mononucleosis, Opportunistic infections Layout: Freeze-dried in plastic vial Organism: Chicken Protein Name: Ovalbumin Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-SIINFEKL-OH Specifications: 8mer peptide as TFA salt
Category: Antigen Peptides Layout: Freeze-dried in plastic vial Organism: Chicken Protein Name: Ovalbumin Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-ISQAVHAAHAEINEAGR-OH
Amount: 1.0 mg net (AAA) Application: Diabetes research Category: Diabetes Peptides Condition / Topic: Diabetes Layout: Freeze-dried in plastic vial Organism: Human Protein Name: Diabetes Peptide Purity: >95% (HPLC-MS) Quantification: Yes Sequence: H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA-OH
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Ultra Peptide Pools Condition / Topic: Infection, Influenza, Malaria, Sequence diversity Layout: Freeze-dried in glass vial Organism: Influenza A, Plasmodium Protein Name: Circumsporozoite protein Purity: Research Plus Grade: each peptide…
Amount: 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) Application: T-cell immunity Category: PepMix Peptide Pools, PepMix Ultra Peptide Pools Condition / Topic: Infection, Malaria, Sequence diversity Layout: Freeze-dried in glass vial Organism: Plasmodium Protein Name: Circumsporozoite protein Purity: Research Plus Grade: each peptide is guaranteed to…
Application: T-cell immunity Category: Antigen Peptides Condition / Topic: Control Layout: Freeze-dried in plastic vial Protein Name: Other Purity: Trial Grade: each peptide purified to > 90% (HPLC/MS) Quantification: No Sequence: H-AKFVAAWTLKAAA-OH
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to peptides?
WhatsApp Us
Online | Privacy policy
WhatsApp us
