LCI peptide
Description
LCI peptide is an antimicrobial peptide with antibacterial activity. LCI peptide is active against plant pathogens, Xanthomonas and Pseudomonas species, including E. coli, gentamicin-resistant MRSA, and Xoo.
Product Details
| Product Name | LCI peptide |
| Biological activity | LCI peptide is an antimicrobial peptide with antibacterial activity. LCI peptide is active against plant pathogens, Xanthomonas and Pseudomonas, including E. coli, Gentamicin-resistant MRSA and Xoo. |
| Appearance | Solid |
| Color | White to off-white |
| Sequence | Ala-Ile-Lys-Leu-Val-Gln-Ser-Pro-Asn-Gly-Asn-Phe-Ala-Ala-Ser-Phe-Val-Leu-Asp-Gly-Thr-Lys-Trp-Ile-Phe-Lys-Ser-Lys-Tyr-Tyr-Asp-Ser-Ser-Lys-Gly-Tyr-Trp-Val-Gly-Ile-Tyr-Glu-Val-Trp-Asp-Arg-Lys |
| Sequence Shortening | AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYEVWDRK |
| Storage | Sealed storage, away from moisture |
