Cys-LL37
Description
Cys-LL37 is a biomaterial with antibacterial properties developed through a method of covalent immobilization onto titanium surfaces. Cys-LL37 uses a flexible hydrophilic polyethylene glycol spacer and selective N-terminal coupling of LL37 to form a surface peptide layer that kills bacteria upon contact. Cys-LL37 can be used in research on the development of novel antibacterial biomaterials.
Product Details
| Product Name | Cys-LL37 |
| Biological activity | Cys-LL37 is a biomaterial with antimicrobial properties developed by covalently fixing to the surface of titanium. Cys-LL37 uses a flexible hydrophilic polyethylene glycol spacer and selective n-terminal coupling LL37, a surface peptide layer that kills bacteria on contact is formed. Cys-LL37 can be used in research to develop new antimicrobial biomaterials. |
| Sequence Shortening | CLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
