Cm-CATH2
Description
Cm-CATH2 is an antimicrobial peptide discovered in the green sea turtle. Cm-CATH2 has potent, broad-spectrum, and rapid bactericidal capacity by rapidly disrupting the integrity of the bacterial cell membrane, showing strong activity against Gram-positive bacteria (such as VREF and Staphylococcus aureus), Gram-negative bacteria (such as E. coli and Klebsiella pneumoniae), and fungi (such as Candida albicans), with MIC values in the range of 1.17-18.75 ??g/mL. Cm-CATH2 is also effective against a variety of aquatic pathogens. Cm-CATH2 not only inhibits biofilm formation but also eradicates preformed biofilms. Cm-CATH2 has immunomodulatory functions and immune cell chemotactic effects, and inhibits pro-inflammatory cytokines produced by LPS (HY-D1056)-stimulated macrophages. Cm-CATH2 prevents NF-??B activation by inhibiting I??B?? degradation, while also inhibiting the phosphorylation of the MAPK signaling pathway (p38, JNK, ERK). Cm-CATH2 demonstrates strong anti-infective capacity in mouse peritonitis and pneumonia models.
Product Details
| Product Name | Cm-CATH2 |
| Biological activity | Cm-CATH2 is an antimicrobial peptide discovered from Chelonia mydas. Cm-CATH2 has a potent, broad-spectrum and rapid bactericidal ability by rapidly destroying the integrity of bacterial cell membranes. It shows strong activity against Gram-positive bacteria (such as VREF, Staphylococcus aureus), Gram-negative bacteria (such as Escherichia coli, Klebsiella pneumoniae), and fungi (such as Candida albicans) with MICs ranges from 1.17 to 18.75 ??g/mL. Cm-CATH2 is also effective against various aquatic pathogenic bacteria. Cm-CATH2 not only inhibits biofilm formation but can also remove the formed biofilms. Cm-CATH2 has immunomodulatory functions and chemotactic effects on immune cells, and can inhibit the production of pro-inflammatory cytokines by macrophages stimulated by LPS (HY-D1056). Cm-CATH2 prevents the activation of NF-??B by inhibiting the degradation of I??B??, and also inhibits the phosphorylation of MAPK signaling pathways (p38, JNK, ERK). Cm-CATH2 demonstrates strong anti-infective ability in mouse peritonitis models and pneumonia models. |
| Sequence | Arg-Arg-Ser-Arg-Phe-Gly-Arg-Phe-Phe-Lys-Lys-Val-Arg-Lys-Gln-Leu-Gly-Arg-Val-Leu-Arg-His-Ser-Arg-Ile-Thr-Val-Gly-Gly-Arg-Met-Arg-Phe |
| Sequence Shortening | RRSRFGRFFKKVRKQLGRVLRHSRITVGGRMRF |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
