Insert HTML here
Andropin is a male-specific antimicrobial peptide present in Drosophila melanogaster.
| Product Name | Andropin |
| Biological activity | Andropin is a male-specific antibacterial peptide that can be found in Drosophila melanogaster. |
| Sequence Shortening | VFIDILDKVENAIHNAAQVGIGFAKPFEKLINPK |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Andropin?
WhatsApp Us
Online | Privacy policy
WhatsApp us