SpHistin
Description
SpHistin is an antimicrobial peptide (AMP). SpHistin can bind LPS (HY-D1056) and permeabilize bacterial membranes. The combination of SpHistin with rifampicin (HY-B0272) and azithromycin (HY-17506) promotes intracellular uptake of the antibiotics, thereby enhancing the bactericidal activity of both drugs against Pseudomonas aeruginosa.
Product Details
| Product Name | SpHistin |
| Biological activity | SpHistin is an antimicrobial peptide (AMP). SpHistin can bind to LPS (HY-D1056) and permeabilize the bacterial membrane. SpHistin combined with Rifampicin (HY-B0272) and Azithromycin (HY-17506) promotes the intracellular uptake of the antibiotics and subsequently enhances the bactericidal activity of both agents against P. aeruginosa. |
| Sequence Shortening | MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLK |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
