NN1213
Description
NN1213, a long-acting human amylin peptide analog, is a selective Amylin receptor agonist with EC50 values of 0.177?and 0.262 nM for hAMY3R and rAMY3R, respectively. NN1213 significantly reduces food intake and fat mass. NN1213 can reduce body weightin diet-induced obese rats. NN1213 can be used for the research of obesity.
Product Information
| Product Name | NN1213 |
| Molecular Weight | 4553.10 |
| Formula | C198H316N56O63S2 |
| Appearance | Solid |
| Color | White to off-white |
| Sequence | {Lys(γGlu-γGlu-C20 diacid)}-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asp-Phe-Leu-Arg-His-Ser-Ser-Pro-Asn-Phe-Gly-Ala-Ile-Pro-Ser-Ser-Thr-Asn-Val-Gly-Ser-Arg-Thr-Tyr-NH2 (disulfide bridge:Cys2-Cys7) |
| Sequence Shortening | {Lys(γGlu-γGlu-C20 diacid)}-CNTATCATQRLADFLRHSSPNFGAIPSSTNVGSRTY-NH2 (disulfide bridge:Cys2-Cys7) |
| Storage | Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month (sealed storage, away from moisture) ???? & ??Ʒ???? ???ȣ? 99.42% ѡ?????Σ? HY-P11245-13***** HY-P11245-12***** Data Sheet (535 KB) SDS (252 KB) COA (289 KB)RP-HPLC (156 KB)MS (68 KB)Ԫ?ط??????? (234 KB) ??Ʒʹ??ָ?? (1538 KB) ?ο????? . Dahl K, et al. NN1213 – A Potent, Long-Acting, and Selective Analog of Human Amylin. J Med Chem. 2024;67(14):11688-11700. ? . Ipsen D, et al. 86-OR: The Amylin Receptor Selective Agonist NN1213 Reduces Food Intake and Body Weight in Rats without Decreasing Calcium Plasma Levels. Diabetes, 2025, 74(Supplement_1): 86-OR. |
