Leucocin A
Description
Leucocin A (LeuA) is a peptide composed of 37 amino acids and belongs to the class II bacteriocins that do not contain lanthionine (HY-135113). Leucocin A has potent antibacterial activity against Gram-positive bacteria, with MIC values of 69 nM and 39 nM against Leuconostoc paramesenteroides and Lactobacillus sake, respectively. Leucocin A can be used in infectious disease research.
Product Details
| Product Name | Leucocin A |
| Biological activity | Leucocin A (LeuA), a 37-amino acid peptide, is a class II bacteriocin without Lanthionine (HY-135113). Leucocin A has potent anti-bacterial activity against gram-positive bacteria, such as Leuconostoc paramesenteroides and Lactobacillus sake with MICs of 69 and 39 nM, respectively. Leucocin A can be used for infectious diseases research. |
| Sequence Shortening | KYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGFW (Disulfide bridge: Cys9-Cys14) |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
