Lactocin 705??
Description
Lactocin 705?? (Lac705??) is a peptide component of Lactocin 705. Lactocin 705?? can interact with zwitterionic DPPC bilayer membranes. Lactocin 705?? induces dehydration at the interfacial region of the bilayer membrane. Lactocin 705?? can be used in research on bacterial infections.
Product Details
| Product Name | Lactocin 705?? |
| Biological activity | Lactocin 705?? (Lac705??) is a peptide component of Lactocin 705. Lactocin 705?? can interact with zwitterionic DPPC bilayers. Lactocin 705?? can induce the dehydration of the bilayer interfacial region. Lactocin 705?? can be used in the research of bacterial infections. |
| Sequence Shortening | GMSGYIQGIPDFLKGYLHGISAANKHKKGRLGY |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
