Bovine tracheal antimicrobial peptide
Description
Bovine tracheal antimicrobial peptide is an antimicrobial peptide derived from the tracheal mucosa. Bovine tracheal antimicrobial peptide has activity against E. coli D31, K. pneumoniae 13883, S. aureus 25923, P. aeruginosa 27853, and C. albicans 14053, with MIC values of 12-25, 12-25, 25-50, 25-50, and 6-12 ??g/ml, respectively.
Product Details
| Product Name | Bovine tracheal antimicrobial peptide |
| Biological activity | Bovine tracheal antimicrobial peptide is a kind of comes from the tracheal mucosa of antimicrobial peptides. Bovine tracheal antimicrobial peptide has activity against E.coli D31, K.pneumoniae 13883, S.aureus 25923, P.aeruginosa 27853 and C.albicans 14053, MIC value 12-25, 12-25, 25-50, 25-50, 6-12 ??g/ml, respectively. |
| Sequence Shortening | NPVSCVRNKGICVPIRCPGSMKQIGTCVGRAVKCCRKK (Disulfide bridge:C5-C34,C12-C27,C17-C35) |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
