| Category: | Abeta Peptides |
|---|---|
| Condition / Topic: | Alzheimer’s disease |
| Layout: | Freeze-dried in plastic vial |
| Organism: | Human |
| Protein Name: | Amyloid beta (A4) protein |
| Purity: | >95% (HPLC-MS) |
| Quantification: | No |
|
Sequence: |
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG |
|---|---|
|
Specifications: |
Synthetic Beta-Amyloid peptide (1-38) |
We use cookies to improve your experience on our site. By using our site, you consent to cookies.
Manage your cookie preferences below:
Essential cookies enable basic functions and are necessary for the proper function of the website.
Google Tag Manager simplifies the management of marketing tags on your website without code changes.
Statistics cookies collect information anonymously. This information helps us understand how visitors use our website.
Google Analytics is a powerful tool that tracks and analyzes website traffic for informed marketing decisions.
Service URL: policies.google.com (opens in a new window)
QYAOBIO
Typically replies within minutes
Any questions related to Beta-Amyloid (1-38) HFIP treated?
WhatsApp Us
Online | Privacy policy
WhatsApp us
