Berobenatide
Description
Berobenatide (PF-08653944; MET-097) is a GLP-1R agonist that exerts functional regulation of GLP-1R biased toward the Gs protein signaling pathway. Berobenatide induces weight loss in diet-induced obese mice. Berobenatide can be used in obesity-related research.
Product Information
| Product Name | Berobenatide |
| Molecular Weight | 5044.75 |
| Formula | C232H369N57O68 |
| CAS Number | 3028974-74-2 |
| Appearance | Solid |
| Color | White to off-white |
| Sequence | Phe-{Aib}-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Lys-Gln-Leu-Glu-Glu-Lys-Arg-Val-Arg-Glu-Phe-Ile-Glu-Trp-Leu-Lys-Gln-Gly-Gly-Pro-Ser-Ser-Gly-Lys-Pro-Pro-Pro-Gly-Lys-{Lys(γGlu-C20 diacid)} |
| Sequence Shortening | F-{Aib}-EGTFTSDVSKQLEEKRVREFIEWLKQGGPSSGKPPPGK-{Lys(γGlu-C20 diacid)} |
| Storage | Sealed storage, away from moisture Powder -80??C 2 years -20??C 1 year *In solvent : -80??C, 6 months; -20??C, 1 month (sealed storage, away from moisture) ???? & ??Ʒ???? Data Sheet (527 KB) ??Ʒʹ??ָ?? (1538 KB) ?ο????? . Hinds C, et al. MET-097: Preclinical Characterization of a Potent and Ultra-Long-Acting GLP-1 Receptor Agonist. Diabetes, 2025, 74(Supplement_1): 794-P. . Lee S, et al. A Lineup for Next Anti-Obesity Medicines: Beyond Incretin-Based Pharmacotherapy. Pharmaceuticals (Basel, Switzerland). 2026 Jul 07;19(7):1047. ? |
