HCoV-OC43 (NCAP)
Description
| Amount: | 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) |
|---|---|
| Application: | T-cell immunity |
| Category: | PepMix Peptide Pools, PepMix Peptide Pools Infections |
| Condition / Topic: | Common cold, Covid-19, Infection, Respiratory infection |
| Layout: | Freeze-dried in glass vial |
| Organism: | Human coronavirus (HCoV) |
| Purity: | Research Plus Grade: each peptide is guaranteed to be main product (HPLC/MS) |
| Quantification: | No |
|
Sequence: |
MSFTPGKQSSSRASSGNRSGNGILKWADQSDQVRNVQTRGRRAQPKQTATSQQPSGGNVVPYYSWFSGITQFQKGKEFEFVEGQGPPIAPGVPATEAKGYWYRHNRGSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVYWVASNQADVNTPADIVDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRTSSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVTKHTAKEVRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNPDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGHKNGQGENDNISVAVPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI
|
|---|---|
|
Specifications: |
Peptide scan (15mers with 11 aa overlap) |



