BKV (small T antigen)
Description
| Amount: | 15 nmol (approx. 25μg) / peptide for stimulation of 2,5 x 108 cells, 25 ug (approx. 15 nmol) / peptide for stimulation of 2,5 x 108 cells, 25 μg (approx. 15 nmol) / peptide (for stimulation of up to 2,5 x 108 cells) |
|---|---|
| Application: | T-cell immunity |
| Category: | PepMix Peptide Pools, PepMix Peptide Pools Infections |
| Condition / Topic: | Infection, Merkel cell carcinoma, Nephritis, interstitial |
| Layout: | Freeze-dried in glass vial |
| Organism: | BK Polyomavirus (BKV) |
| Protein Name: | Small T antigen |
| Purity: | >70% (HPLC-MS), Development Grade: each peptide purified to > 70% (HPLC/MS) |
| Quantification: | No |
|
Sequence: |
MDKVLNREESMELMDLLGLERAAWGNLPLMRKAYLRKCKEFHPDKGGDEDKMKRMNTLYKKMEQDVKVAHQPDFGTWSSSEVCADFPLCPDTLYCKEWPICSKKPSVHCPCMLCQLRLRHLNRKFLRKEPLVWIDCYCIDCFTQWFGLDLTEETLQWWVQIIGETPFRDLKL
|
|---|---|
|
Specifications: |
Peptide scan (15mers with 11 aa overlap) |



