Vasoactive Intestinal Peptide

Home » Catalog Peptides » Vasoactive Intestinal Peptide

Vasoactive intestinal peptide (vasoactive intestinal polypeptide or VIP) is a hormone peptide in the intestine with vaso-activity. It is a peptide with 28 amino acids, and belongs to the group of glucagon/secretin.

Notice: All peptides are only for research purposes, Not for clinical use.

VIP  Peptides

VIP, Vasoactive Intestinal Peptide, human, porcine, rat
  • Name: VIP, Vasoactive Intestinal Peptide, human, porcine, rat
  • Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
  • CAS Number: [40077-57-4]
  • Formula: C147H238N44O42S1
  • Characteristics: None
  • Reference: J.J. Segura et al., Reg. Pep., 37, 145 (1992)
VIP, Vasoactive Intestinal Peptide, guinea pig
  • Name: VIP, Vasoactive Intestinal Peptide, guinea pig
  • Sequence: HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2
  • CAS Number: [96886-24-7]
  • Formula: C147H239N43O42S2
  • Characteristics: None
  • Reference: B.H. Du et al., BBRC, 128, 1093 (1985)
Vasoactive Intestinal Contractor [VIC]
  • Name: Vasoactive Intestinal Contractor [VIC]
  • Sequence: CSCNSWLDKECVYFCHLDIIW (Remark: Disulfide bridges:C1-C15,C3-C11)
  • CAS Number: [138863-63-5]
  • Formula: C116H161N27O32S4
  • Characteristics: Cys1-Cys15, Cys3-Cys11 bridge
  • Reference: None
VIP (10-28),Vasoactive Intestinal Peptide (10-28), human, bovine, porcine, rat
  • Name: VIP (10-28),Vasoactive Intestinal Peptide (10-28), human, bovine, porcine, rat
  • Sequence: YTRLRKQMAVKKYLNSILN-NH2
  • CAS Number: [69856-17-3]
  • Formula: C105H180N32O26S
  • Characteristics: None
  • Reference: None
VIP AntagonistVasoactive Intestinal Peptide Antagonist
  • Name: VIP Antagonist|Vasoactive Intestinal Peptide Antagonist
  • Sequence: KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2
  • CAS Number: [125093-93-8]
  • Formula: C154H257N49O40S
  • Characteristics: None
  • Reference: None
Vasoactive Intestinal Peptide (6-28)VIP (6-28) (human, bovine, porcine, rat)
  • Name: Vasoactive Intestinal Peptide (6-28)|VIP (6-28) (human, bovine, porcine, rat)
  • Sequence: FTDNYTRLRKQMAVKKYLNSILN-NH2
  • CAS Number: [69698-54-0]
  • Formula: C126H207N37O34S
  • Characteristics: None
  • Reference: None
(D-Phe2)-VIP,[D-Phe2]-Vasoactive Intestinal Peptide, human, bovine, porcine, rat
  • Name: (D-Phe2)-VIP,[D-Phe2]-Vasoactive Intestinal Peptide, human, bovine, porcine, rat
  • Sequence: HfDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 (Remark:f is D-Phe)
  • CAS Number: [104051-15-2]
  • Formula: C153H242N44O41S
  • Characteristics: None
  • Reference: None
[Pyr16]-Vasoactive Intestinal Peptide (16-28), chicken
  • Name: [Pyr16]-Vasoactive Intestinal Peptide (16-28), chicken
  • Sequence: (Pyr)-MAVKKYLNSVLT-NH2
  • CAS Number: [73073-47-9]
  • Formula: C67H113N17O18S
  • Characteristics: None
  • Reference: None
[Pyr16]-Vasoactive Intestinal Peptide (16-28), human, bovine, porcine, rat
  • Name: [Pyr16]-Vasoactive Intestinal Peptide (16-28), human, bovine, porcine, rat
  • Sequence: (Pyr)-MAVKKYLNSILN -NH2
  • CAS Number: [134907-86-1]
  • Formula: C68H141N18O18S
  • Characteristics: None
  • Reference: None
Biotin-Vasoactive Intestinal Peptide, human, bovine, porcine, rat
  • Name: Biotin-Vasoactive Intestinal Peptide, human, bovine, porcine, rat
  • Sequence: Biotin-HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
  • CAS Number: None
  • Formula: C157H252N46O44S2
  • Characteristics: None
  • Reference: None
Vasoactive Intestinal Peptide (1-12), human, porcine, rat
  • Name: Vasoactive Intestinal Peptide (1-12), human, porcine, rat
  • Sequence: HSDAVFTDNYTR
  • CAS Number: [120928-03-2]
  • Formula: C61H88N18O22
  • Characteristics: None
  • Reference: None
Vasoactive Intestinal Peptide-Lys(Biotin), human, porcine, rat
  • Name: Vasoactive Intestinal Peptide-Lys(Biotin), human, porcine, rat
  • Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILNK(Biotin)
  • CAS Number: None
  • Formula: C163H263N47O46S2
  • Characteristics: None
  • Reference: None
Call Us

+86(021)-50795728
+86(027)-60707970