Pituitary Adenylate Cyclase Activating Polypeptide
Pituitary adenylate cyclase-activating polypeptide (PACAP) is a 27- or 38-amino acid neuropeptide, it is encoded by the ADCYAP1 gene in human. PACAP is similar to vasoactive intestinal peptide, it can stimulate enterochromaffin-like cells.
In reason of the high homology of amino acid sequences of PACAP and VIP, these peptides share 3 class B-G-protein coupled receptors: the PAC1-Receptor (PAC1-R), the VPAC1-Receptor (VPAC1-R) and VPAC2-Receptor (VPAC2-R).
Notice: All peptides are only for research purposes, Not for clinical use.
PACAP Peptides

- Name: PACAP (1-38), human, ovine, rat
- Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
- CAS Number: [124123-15-5]
- Formula: C203H331N63O53S1
- Characteristics: None
- Reference: A. Miyata et al., BBRC, 164, 567 (1989) K. Ogi et al., BBRC, 173, 1271 (1990)

- Name: PACAP-27, human, mouse, ovine, porcine, rat
- Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
- CAS Number: [127317-03-7]
- Formula: C142H224N40O39S1
- Characteristics: None
- Reference: A. Miyata et al., BBRC, 164, 567 (1989) A. Mirata et al., Regulatory Peptides, 26, 170 (1989)

- Name: PACAP-38 (6-38) (human, chicken, mouse, ovine, porcine, rat)
- Sequence: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
- CAS Number: [143748-18-9]
- Formula: C182H300N56O45S1
- Characteristics: None
- Reference: P. Robberecht et al., Mol. Pharmacol., 42, 347 (1992) P. Robberecht et al., Eur. J. Biochem., 207, 239 (1992) F. Ohno et al., Regul. Peptides, 126, 115 (2005)

- Name: PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat)
- Sequence: GKRYKQRVKNK-NH2
- CAS Number: [160489-86-1]
- Formula: C61H110N24O14
- Characteristics: None
- Reference: None

- Name: PACAP Related Peptide (1-29) (rat)
- Sequence: DVAHEILNEAYRKVLDQLSARKYLQSMVA
- CAS Number: [132769-35-8]
- Formula: None
- Characteristics: None
- Reference: None
Call Us
+86(021)-50795728
+86(027)-60707970
