Neuropeptide Y

Home » Peptide » Catalog Peptides » NPY

Neuropeptide Y (NPY) is a 36 amino-acid neuropeptide, it is involved in different physiological and homeostatic processes in both central and peripheral nervous systems. Normally, it is secreted alongside other neurotransmitters like: GABA and glutamate.

It is a strong vasoconstrictor, and causes growth of fat tissue in the autonomic system. In the brain, it has several functions, including: controlling epileptic seizures, lowering blood pressure, reducing pain perception, reducing anxiety and stress, affecting the circadian rhythm, increasing food intake and storage.

Notice: All peptides are only for research purposes, Not for clinical use.

NPY Peptides

1.Neuropeptide Y, porcine
  • Name: Neuropeptide Y, porcine
  • Sequence: YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2
  • CAS Number: [83589-17-7]
  • Formula: C190H287N55O57
  • Characteristics: None
  • Reference: K. Tatemoto et al., PNAS, 79, 5485 (1982)
2.Neuropeptide FF; F-8-F-NH2
  • Name: Neuropeptide FF; F-8-F-NH2
  • Sequence: FLFQPQRF-NH2
  • CAS Number: [99566-27-5]
  • Formula: C54H76N14O10
  • Characteristics: None
  • Reference: M.Xu et al., Peptides, 22, 33 (2001)  C.Mollereau et al., Pharmacol. Rep., 63, 1061 (2011)
3.Neuropeptide Y, human,rat
  • Name: Neuropeptide Y, human,rat
  • Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
  • CAS Number: [90880-35-6]
  • Formula: C189H285N55O57S1
  • Characteristics: None
  • Reference: Minth, C. et al. Proc. Natl. Acad. Sci. USA 81, 4577 (1984)
4.[Leu31,Pro34] Neuropeptide Y, human
  • Name: [Leu31,Pro34] Neuropeptide Y, human
  • Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLLTRPRY-NH2
  • CAS Number: [132699-73-1]
  • Formula: C189H284N54O56S1
  • Characteristics: None
  • Reference: Chen, S. and RJ. Cheung, Biomed. Sci. 11, 781 (2004)  Chen, S. and RJ. Cheung, Biomed. Sci.12, 267 (2005)
5.Neuropeptide Y, human, Free Acid
  • Name: Neuropeptide Y, human, Free Acid
  • Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
  • CAS Number: [99575-89-0]
  • Formula: C189H284N54O58S1
  • Characteristics: None
  • Reference: None
Call Us

+86(021)-50795728
+86(027)-60707970