Neuromedin
Neuromedins (also known as smooth-muscle-stimulating peptides) are normally divided into four groups: bombesin-like, kassinin-like, neurotensin-like and neuromedins U.
Neuromedin B (NMB) is a bombesin-related peptide in mammals. It is present in human central nervous system and gastrointestinal tract.
Neuromedin C is a gastrin-releasing peptide, it stimulates the gastrin release. Neuromedin C provides the negative feedback to regulate fear.
Neuromedin U (NmU or NMU) is a neuropeptide in brain of mammals, it has diverse functions in regulation of blood pressure, contraction of smooth muscle, pain perception, bone growth, appetite, hormone release.
Neuromedin S is a neuropeptide with 36-amino acid in the brain of mammals. It is secreted in suprachiasmatic nucleus of the hypothalamus.
Notice: All peptides are only for research purposes, Not for clinical use.
Neuromedin

- Name: Neuromedin B, porcine
- Sequence: GNLWATGHFM-NH2
- CAS Number: [87096-84-2]
- Formula: C52H73N15O12S1
- Characteristics: None
- Reference: None

- Name: Neuromedin C, porcine
- Sequence: GNHWAVGHLM-NH2
- CAS Number: [81608-30-2]
- Formula: C50H73N17O11S1
- Characteristics: None
- Reference: K.A. Roth et al., BBRC, 112, 528 (1983)

- Name: Neuromedin U-23, rat
- Sequence: YKVNEYQGPVAPSGGFFLFRPRN-NH2
- CAS Number: [117505-80-3]
- Formula: C124H180N34O31
- Characteristics: None
- Reference: N. Minamino et al., BBRC, 156, 685 (1984)
![4.[Leu116]-Prepro-Neuromedin U (104-136), human](https://www.qyaobio.com/wp-content/uploads/2024/03/4-1-9.jpg)
- Name: [Leu116]-Prepro-Neuromedin U (104-136), human
- Sequence: FLFHYSKTQKLGLSNVVSSVVHPLLQLVPHLHE
- CAS Number: None
- Formula: C177H276N46O45
- Characteristics: None
- Reference: None
![5. [Ser2]-Neuromedin C](https://www.qyaobio.com/wp-content/uploads/2024/03/5-1-7.jpg)
- Name: [Ser2]-Neuromedin C
- Sequence: GSHWAVGHLM-NH2
- CAS Number: [136058-54-3]
- Formula: C67H87N15O14
- Characteristics: None
- Reference: None

- Name: Biotin-Neuromedin B
- Sequence: Biotin-GNLWATGHFM-NH2
- CAS Number: None
- Formula: C62H87N17O14S2
- Characteristics: None
- Reference: None

- Name: Biotin-Neuromedin S, human
- Sequence: Biotin-ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2
- CAS Number: None
- Formula: C183H279N55O46S
- Characteristics: None
- Reference: None

- Name: Biotin-Neuromedin S, rat
- Sequence: Biotin-LPRLLHTDSRMATIDFPKKDPTTSLGRPFFLFRPRN-NH2
- CAS Number: None
- Formula: C202H321N59O5S2
- Characteristics: None
- Reference: None

- Name: Prepro-Neuromedin S (70-103), human
- Sequence: FLFHYSRTQEATHPVKTGFPPVHPLMHLAAKLAN
- CAS Number: None
- Formula: C180H271N49O44S
- Characteristics: None
- Reference: None

- Name: Prepro-Neuromedin U (104-136), human
- Sequence: FLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHE
- CAS Number: None
- Formula: C177H277N47O45
- Characteristics: None
- Reference: None
Call Us
+86(021)-50795728
+86(027)-60707970
