Fibronectin Peptide
Fibronectin is a glycoprotein with high molecular weight (500-600 kDa), it binds to integrins (membrane-spanning receptor proteins). Fibronectin peptides have high apparent affinity and efficacy in wound repair stimulation.
Notice: All peptides are only for research purposes, Not for clinical use.
Fibronectin Peptides

- Name: Fibronectin CS1 Peptide
- Sequence: EILDVPST
- CAS Number: [136466-51-8]
- Formula: C38H64N8O15
- Characteristics: C-terminal fragment of the connecting segment 1 (Cs-1) in human fibronectin
- Reference: E.A. Wayner et al., JCB, 109, 1321 (1989)

- Name: Fibronectin-Binding Protein Peptide D3
- Sequence: FNKHTEIIEEDTNKDKPSYQFGGHNSVDFEEDTLPKV
- CAS Number: [119977-20-7]
- Formula: C190H283N49O66
- Characteristics: Synthetic peptide that mimics the structure of a 38-amino acid unit from a staphylococcal fibronectin-binding protein.
- Reference: C. Signas et al., PNAS, 86, 699 (1989)
![[Phe1376]-Fibronectin Fragment (1371-1382)](https://www.qyaobio.com/wp-content/uploads/2023/10/Phe1376-Fibronectin-Fragment-1371-1382.jpg)
- Name: [Phe1376]-Fibronectin Fragment (1371-1382)
- Sequence: RQDRVFHSRNSI
- CAS Number: [174063-90-2]
- Formula: C63H103N25O19
- Characteristics: None
- Reference: None

- Name: Fibronectin CS-1 Fragment (1978-1982), human, bovine, rat
- Sequence: EILDV
- CAS Number: [150525-67-0]
- Formula: C26H45N5O10
- Characteristics: None
- Reference: None

- Name: Fibronectin Adhesion-Promoting Peptide
- Sequence: WQPPRARI
- CAS Number: [125720-21-0]
- Formula: C47H74N16O10
- Characteristics: None
- Reference: None

- Name: Fibronectin Analog
- Sequence: GRADSPK
- CAS Number: [125455-58-5]
- Formula: C29H51N11O11
- Characteristics: None
- Reference: None

- Name: Fibronectin Type III Connecting Segment (1-25)
- Sequence: DELPQLVTLPHPNLHGPEILDVPST
- CAS Number: [107978-77-8]
- Formula: C123H195N31O39
- Characteristics: None
- Reference: None
Call Us
+86(021)-50795728
+86(027)-60707970
