Dendroaspis Natriuretic Peptides
Dendroaspis natriuretic peptide (DNP) is a 38-residue peptide, it is a member of natriuretic peptide family. It has similar structure as the atrial natriuretic peptide (ANP), brain natriuretic peptide (BNP), and C-type natriuretic peptide (CNP), and also possesses biologic properties similar to other natriuretic peptides.
DNP is isolated originally from the venom of Dendroaspis angusticeps, this is derived from the name. DNP is a newly-described natriuretic peptide, it lowers blood pressure via vasodilation.
Notice: All peptides are only for research purposes, Not for clinical use.
Dendroaspis Natriuretic Peptides
![2. [Des-Arg30,Des-Pro31]-Dendroaspis Natriuretic Peptide](https://www.qyaobio.com/wp-content/uploads/2024/01/2-12.jpg)
- Name: [Des-Arg30,Des-Pro31]-Dendroaspis Natriuretic Peptide
- Sequence: EVKYDPCFGHKIDRINHVSNLGCPSLRDPNAPSTSA
- CAS Number: None
- Formula: C169H263N51O54S2
- Characteristics: None
- Reference: None

- Name: Dendroaspis Natriuretic Peptide
- Sequence: EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA
- CAS Number: [255721-52-9]
- Formula: C180H282N56O56S2
- Characteristics: (Cys7-Cys23 bridge)
- Reference: None
Call Us
+86(021)-50795728
+86(027)-60707970
