Apelin
Apelin is a peptide encoded by the APLN gene in human, it is also known as APLN. Apelin peptide is an endogenous ligand for the G-protein-coupled APJ receptor, which is expressed at the surface of cells.
Notice: All peptides are only for research purposes, Not for clinical use.
Apelin Peptides

- Name: Apelin-36|Apelin(human)
- Sequence: LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
- CAS Number: [252642-12-9]
- Formula: C184H297N69O43S1
- Characteristics: None
- Reference: None

- Name: (Glp1)-Apelin-13, human, bovine
- Sequence: (Glp)-RPRLSHKGPMPF
- CAS Number: None
- Formula: C69H108N21O16S1
- Characteristics: None
- Reference: K. Tatemoto et al., Biochem Biophy. Res. Commun., 251, 471 (1998)

- Name: Apelin-13, human, bovine
- Sequence: QRPRLSHKGPMPF
- CAS Number: [217082-58-1]
- Formula: C69H108N21O16S1
- Characteristics: None
- Reference: K. Tatemoto et al., Biochem Biophy. Res. Commun., 251, 471 (1998)
Call Us
+86(021)-50795728
+86(027)-60707970
