Prolactin Releasing Peptide

Home » Peptide » Catalog Peptides » Prolactin Releasing Peptide

Prolactin-releasing peptide (PrRP) is a peptide hormone, which is encoded by the PRLH gene. PrRP stimulates the release of prolactin (PRL), and regulates the expression of prolactin by binding to the prolactin-releasing peptide receptor (GPR10).

PrRP has 20 amino acids, it is a member of RF-amide peptide family. PrRP is a ligand for the orphan G-protein coupled receptor (GPR 10), it stimulate the secretion of prolactin from lactotropic cells.

Notice: All peptides are only for research purposes, Not for clinical use.

Prolactin Releasing Peptide

1.Prolactin Releasing Peptide (1-31), human
  • Name: Prolactin Releasing Peptide (1-31), human
  • Sequence: SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2
  • CAS Number: [215510-22-8]
  • Formula: C160H252N56O42S1
  • Characteristics: None
  • Reference: Engström, et al. J. Pharmacol. Exp. Ther. 305, 825 (2003)
2.Prolactin Releasing Peptide (1-31), rat
  • Name: Prolactin Releasing Peptide (1-31), rat
  • Sequence: SRAHQHSMETRTPDINPAWYTGRGIRPVGRF-NH2
  • CAS Number: [215510-06-8]
  • Formula: C156H242N54O43S1
  • Characteristics: None
  • Reference: S. Hinuma, et al. Nature, 393, 272 (1998)
Call Us

+86(021)-50795728
+86(027)-60707970